KEGG   Calothrix sp. PCC 7507: Cal7507_3631Help
Entry
Cal7507_3631      CDS       T02358                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
calo  Calothrix sp. PCC 7507
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cal7507_3631
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Cal7507_3631
Enzymes [BR:calo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cal7507_3631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4120666..4121766)
Genome map
AA seq 366 aa AA seqDB search
MPVSQELKHFGNHLILGISGTTLSDEDKYALSELQPVGVIFFAKNFLDGAPYEIWLQAFK
ELIDQIRQYAERDSMFITLDHEGGRVVRTPLPITRFPYAFLLRSHAREVAKATSVELKSL
GINVSWAPIADIYSHPQNPIIGARAFGITPETAAQAAVEYYLGLQESGILGSAKHFPGHG
DTSKDSHIELPILDLTIEDLRNRELIPFKALIEAQVPLVMTAHILFPKIDPDVPATLSQA
ILNGILRQELGFDGVVVSDDLDMKAISDMFIQPGTVARSINAGCDLFIVSRNINSSSIER
TYQIAASFADSLSNGSLQESVVAAARARIEKLLAVTPQYLVHYLDKDTLKQHAELAIACS
FQQVGV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccagtatcgcaggagctaaaacactttgggaatcatttgattctgggtatttctggc
actactttgagtgatgaggataaatacgcactcagtgaactgcaaccagtaggggtgatt
ttttttgcgaaaaactttttggatggtgccccctatgagatttggttacaagcctttaag
gagttgattgaccagatcagacaatacgccgaacgggattccatgttcattaccctggat
catgaggggggtcgtgttgtgcggacaccgttgccaattacgcgatttccttatgccttt
ttattgcgatcgcacgcccgcgaggtagcaaaagcaacatctgtcgaactcaaatcttta
ggcatcaatgtatcctgggcacccatagccgatatttattcccatccgcaaaatccgatt
attggcgcccgtgcttttggtatcactcctgagactgcagcccaagctgctgttgagtac
tatctcggactccaggaatcaggaattttgggaagcgccaaacacttcccaggtcatgga
gacacaagcaaggactctcacattgagttaccaatccttgatttaacgatagaagacctg
cgaaatcgggaactgataccgtttaaagcactgattgaggcgcaagtaccgttagtgatg
acagcccacatcctgtttcccaaaatagaccctgatgtaccagcaaccctatctcaggct
attctcaatggcatcctgcgccaggaactgggttttgatggggtggtggtgtctgatgat
ttggatatgaaagctatttccgatatgtttatccaaccagggactgtggcgcggtcaatt
aatgctggttgcgatttatttatcgtctcgcgcaacatcaattcatcatcgattgaacga
acatatcagatagctgcaagttttgccgattctctgagtaatgggagtcttcaggagtca
gtagtggctgctgcgagggcgagaatcgagaaattactcgcggtaactccgcaatatctt
gttcattatttggataaagatactttaaaacaacatgccgaattagcgatcgcttgttct
ttccaacaagtcggggtgtga

DBGET integrated database retrieval system