KEGG   Calothrix sp. PCC 7507: Cal7507_3911Help
Entry
Cal7507_3911      CDS       T02358                                 

Definition
cyclic nucleotide-binding protein (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cal7507_3911
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal7507_3911
   00620 Pyruvate metabolism
    Cal7507_3911
   00650 Butanoate metabolism
    Cal7507_3911
  Lipid metabolism
   00071 Fatty acid degradation
    Cal7507_3911
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cal7507_3911
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cal7507_3911
   00626 Naphthalene degradation
    Cal7507_3911
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cal7507_3911
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cal7507_3911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4442221..4444140
Genome map
AA seq 639 aa AA seqDB search
MKNALNSLLEPLNKLSASEQMVLENIMQPVIFSAGTYIFKEGGIADSCYILKEGIVRIET
ASENNSNFVLNYLEAGTIFGEISVLDKMPRSATAYAQTNIIAKKILIKELELLLETYPKI
LVCLWEVFGKTAALRVRSLQELAIKKNNFEIYPEVEEMLDKALQAQKEIQTWSEERIDAL
LLVIASSVAEHAESLAIATVKATRVGDISDKVTKNKIASLGIYRSLVGKSGCGYISNYKI
NNVCEIASPMGIIFGMIPMTNPVATAVFKALICIKSRNALILSFPLSTKNVGTLVCEIIQ
EALIRQDAPVDLIQWLKHRSSREQTEILMKHKNVSLILATGGANMVKAAYSSGTPAIGVG
PANTPTLICADANIQHAARSIIVSKSFDNGLICGSEHNLIVDARVRKNFIKVLEQEGAAI
LTQEEKSYFSTVAFEDQSHRLQAKIIGQSAAKIAAMANIKRDYSIKVIIVPNESVNLDNP
YAYEKMAPILSLFTVQNEIEGIELCRRILQIEGKGHTAIIHTKNKALVRRFGLEMPASRI
LVNSPGVHGIIGLTSALDPSFTLGCGTFGGNSTTDNVTYRHLLNLKRIAYYQAPKFLDPE
IFKNTYPWWLLQLLNLLNFLKLNSLVTFISQLVSIELRR
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcattaaactcgcttctagaaccattaaataaactttcggcatctgaacaa
atggttttagaaaatataatgcaacctgttatattttcagccggaacttatatatttaaa
gaaggtgggatcgcggatagctgttacatccttaaagaaggtatagtacggattgaaacg
gcatcagagaataattctaattttgtacttaattatttggaagctgggacaatttttgga
gaaataagcgtattagataaaatgcctcgttcggctactgcttatgctcaaacaaatata
atagctaaaaaaatactaattaaagagttagaactcttattagaaacttatccaaaaata
ttagtttgtctctgggaagtgtttggaaaaactgctgccctgagagttcgttctttgcag
gaattggcgattaaaaaaaataacttcgagatatacccagaagtggaagaaatgctcgat
aaagctttacaagctcaaaaagaaattcaaacttggtctgaagaacgtatagatgcctta
ttactcgtaattgcttcatcagttgcggaacacgccgaatcattagcaatagcaacagta
aaggctactcgtgttggggatatttcggataaagttactaagaataaaattgctagcttg
ggtatttatcgctcgctggttggtaaatctggatgcggatatatctcaaattataaaatt
aataatgtttgtgaaatagcaagtccaatgggaattatttttggcatgattcccatgact
aacccagttgcaacagcagtttttaaagctttaatttgtataaaaagccgtaatgcactg
attttaagtttcccactttctactaagaatgttggcacgttagtttgtgaaattattcag
gaagctttaattcggcaagatgcacctgtagacctgattcagtggttaaaacatcgtagt
tcccgcgaacaaacagaaatattaatgaagcataaaaacgtctccttaattttagcaaca
ggaggcgcgaatatggtgaaagctgcttatagttccggaactccggcaattggtgtgggt
cctgctaatacgcctaccttaatttgtgcggatgcaaatattcaacatgctgcccgcagt
attattgtcagcaaatcatttgataatggattgatttgtggttctgaacataatttaata
gttgatgcacgagttaggaagaactttattaaagtattagaacaagaaggtgcagcaata
cttacacaggaagaaaaaagctactttagcaccgttgcttttgaagatcaatcgcatcga
ttgcaagcaaaaattattggtcagtcagcggctaaaattgctgctatggcaaatattaaa
cgcgattattccatcaaagtaattatagttccgaatgaatctgtaaatttagataatcca
tatgcttatgagaagatggcaccgatactgagtttatttacggttcaaaatgagattgaa
ggtatagagctttgtcggaggatattacagatagaagggaaaggacatacagccattatt
cacacaaaaaataaggcattagtgagaagatttgggttagaaatgccagctagtagaata
ttagtaaattcgccaggagtacatggaattataggtttgacaagcgctttagacccatca
ttcacattagggtgcggtacgtttgggggaaattcaactactgataatgttacttatcgc
catcttttgaatttaaaacggatcgcatattatcaagcgccaaagtttttagatccagag
atatttaaaaatacatatccctggtggttactgcaattactgaacttattaaacttttta
aaactcaattctttagttacatttatatcgcaactagtttcgattgaattgagaagataa

DBGET integrated database retrieval system