KEGG   Calothrix sp. PCC 7507: Cal7507_3945Help
Entry
Cal7507_3945      CDS       T02358                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00010  Glycolysis / Gluconeogenesis
calo00520  Amino sugar and nucleotide sugar metabolism
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
calo01120  Microbial metabolism in diverse environments
calo01130  Biosynthesis of antibiotics
calo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal7507_3945
   00520 Amino sugar and nucleotide sugar metabolism
    Cal7507_3945
Enzymes [BR:calo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cal7507_3945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF2993
Motif
Other DBs
NCBI-ProteinID: AFY34333
UniProt: K9PMJ8
Position
4479469..4480176
Genome map
AA seq 235 aa AA seqDB search
MVDENGSIRTLSVDIGGSGVKAMVLDITGTPITERGRLDTPQPAKPDVVINAIAVLAAAQ
GEFHRVSVGFPGVVRCGVTETAVNLDRDWIGFNLETALSQQLRKPVRVINDADMQGFGAI
AGKGVELVITLGTGFGSALFVDGKLVPNMEMGHHQFRKGETYEEQLGRAILEKIGDKKWN
KRLEKAIASLQNLFNYDCLYIGGGEAVRVNMHLPLNVKLIPNITGLLGGIALWRN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgaaaatggatcaattcgcaccctatcagttgatattggcgggagtggtgtc
aaagcgatggtattggatattacagggactcccatcacagaaaggggacgtttagataca
ccccagccggcaaaacctgatgttgtaattaatgcgatcgcagttttagcagctgcacaa
ggtgagtttcatcgcgtttcggtgggttttcctggagtggtgcgctgtggcgtgacggaa
acagccgtcaacttagatcgagattggattgggtttaacttagaaaccgcattgtcgcaa
caattaagaaagcctgtacgagtgattaatgatgcagatatgcagggatttggggcgatc
gctggcaaaggcgtagaattagtgattaccttggggactgggtttggttctgcattgttt
gtggatggcaaactagtaccaaatatggaaatgggacatcatcagtttcgcaaaggagaa
acctacgaagaacaactagggcgggcgatattggaaaaaatcggcgataaaaaatggaat
aagcggttagaaaaagcgatcgcctctttgcaaaatctcttcaactatgattgcctttac
atcggcggtggtgaagccgtcagagtgaatatgcatctacccctaaacgtcaaactcatc
cccaatatcaccggtttattaggcggtattgctttgtggcgaaattag

DBGET integrated database retrieval system