KEGG   Calothrix sp. PCC 7507: Cal7507_4430Help
Entry
Cal7507_4430      CDS       T02358                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:calo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:calo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5036366..5037649)
Genome map
AA seq 427 aa AA seqDB search
MQLLQTTDQDFSAKFSTLVSDRREATVDVSGTVRDILANVKARGDAAVKEYTSRFDHFDL
QSLRLTDSFIAEQAAKCPAEVKSALELAASRISAFHDKQLPVNVDFTDSVGVRLGLNWVA
LSQVGIYVPGGRASYPSSVLMNALPAKIAGVERIVMTVPMPKGEINPAVLAAAQIAGVTE
IYGIGGAQAIAALAYGTQSIVPVDKIVGPGNAYVAEAKRQVFGTVGIDSIAGPSEILVVA
DSKNNPDWIAWDLLSQAEHDPSAQSILITDSEIFAQKVISAVEQVLANLPTKEVARASWQ
EHGAVILVSDLGQSIPLLNQLAPEHVELCVDEPQLLANQIRCAGSIFLGRYTPEAIGDYL
GGPNHVLPTARSARFASGLSVYDFLKRITYLECNQQSLQAIGKAAVTLAEAEGLPAHAGS
VAVRLTP
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaactacttcaaaccaccgatcaagacttttcagccaaatttagcacactcgtgagc
gatcgccgggaagctacagttgatgttagcgggacagtccgagatattttggctaatgtc
aaagctcgtggtgatgcagcagttaaagaatataccagccgcttcgaccattttgacctc
cagtcgctgcgtctcactgatagctttattgccgaacaagccgccaaatgtcccgcagag
gtgaaatcagcactggaactggcagcgtcgcgaattagtgcttttcatgacaagcaattg
ccagtaaatgtggattttactgatagcgtcggggtgagattgggattaaattgggtagcc
ctgtcacaagtgggaatttacgtacctggaggacgcgccagctatcccagttctgtgttg
atgaacgcattacctgccaaaattgcaggcgtagagcggattgtgatgacagtacccatg
ccgaagggcgagattaatcccgcagtattggcagccgctcaaattgcgggtgtaactgaa
atatacggtattggtggggcgcaagcgatcgccgccttagcttatggcactcaaagcatt
gtccctgtagataaaatagttggccctggtaacgcttacgttgctgaagccaaacgccaa
gtatttggcaccgtgggcattgacagcatagctgggccctcagaaattctggttgtcgct
gatagcaaaaataatcccgactggattgcttgggatttactctcacaagcagaacacgat
cctagtgcccagtcaattttgattaccgattcggaaatatttgctcagaaagtgatttcg
gcggttgaacaagtcctcgctaacttaccgacgaaagaagtagctagagccagttggcaa
gaacatggagcagtaattctagtcagtgacttagggcaaagcataccgttactcaatcaa
ctcgctccagaacacgtggaattgtgcgtagacgagccacaactgctggctaatcagatt
aggtgtgcggggagcatatttttgggacgctataccccagaagccattggcgattattta
ggaggccccaaccatgtactacctaccgcccgttcagcccgttttgcctctgggttgagt
gtttacgattttctcaagcggattacctatttagaatgcaatcaacagtcattgcaggcg
atcggcaaagcagccgtgaccctagcagaagcagaaggcttgccagctcacgcaggtagt
gtggcggtgcggctgacaccatga

DBGET integrated database retrieval system