KEGG   Calothrix sp. PCC 7507: Cal7507_4612Help
Entry
Cal7507_4612      CDS       T02358                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cal7507_4612
Enzymes [BR:calo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cal7507_4612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5234905..5235423
Genome map
AA seq 172 aa AA seqDB search
MRGLSPQDSYSVKTSAIALGSNIGDSQAILEAAVETLARTPGILLTAKSSWYQTKAIGPA
QPDYINGCILLQIVMLPQLLLETLLNIEQKFGRVRQERWGPRTLDLDLLLYDDLILQTPT
LQIPHPRMKERAFVLVPLAEIAPDWVDPVSGCVIKDLVKQVDCSDVHLLLGN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggcttagtccccaagatagctactcagtaaagactagcgccatcgcccttggt
agcaatattggtgattcgcaggcaatattagaagcagctgtcgaaactttagctcgaaca
ccaggtattcttttaacagcaaaatctagttggtatcaaaccaaagcaataggcccagcc
cagccagattacataaatggctgcatcctcttacaaatagttatgctaccgcagctgttg
ttagaaactttattaaacatcgaacaaaagttcgggcgtgttcgccaagaacgttggggg
ccacgaaccttagatttagatttattgttatatgatgacctaattttgcagacgccaacc
ctgcaaattccccatccccgcatgaaagaaagggcttttgtgttagttccactagcagaa
atcgccccggattgggtagatcctgtttctgggtgtgttatcaaggatttggttaaacag
gtagactgttctgatgtacatttattgttaggcaattaa

DBGET integrated database retrieval system