KEGG   Calothrix sp. PCC 7507: Cal7507_5125Help
Entry
Cal7507_5125      CDS       T02358                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cal7507_5125
Enzymes [BR:calo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cal7507_5125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5813524..5814573
Genome map
AA seq 349 aa AA seqDB search
MSNQQPDYDPSGVGEINGNLLGLPFDYEGANLIVIGVPWEVTVSYKAGTANGPQQILNAS
TQLDLFDFDHPSGWKQGIFMVEIPQDILEKNKYYRTLAAEIIERLAQGKSLTDTPDLTSI
LTEINQACEQVNQWLFAQSQEAIKNGKRVAVIGGDHSSPLGYFQALAARYTNYGILHIDA
HADLRDAYEGFEFSHASIMFNAMKIPQITKLVQVGLRDICHDEVEIIDQSNGRIVAYYDP
AIKQRLYSGSTWINLCREIISHLPEYVYISFDVDGLDPKLCPNTGTPVPGGLELEQAFCL
FRELINSDRKIIGFDVCEVGDAEWDGNVGARIVYKLANFLDLSQQGNRE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaacaaccggactacgatcccagtggggtaggtgaaatcaatggcaacctt
cttggtttaccatttgactatgaaggagccaatctgatcgttattggtgtaccgtgggaa
gttactgtatcctacaaagcaggtaccgccaacggcccgcagcaaattttaaatgcttcg
actcaactggatttgttcgattttgatcatcctagtggatggaaacagggaatttttatg
gtagaaattccccaggatattttagagaagaataaatactatcgcaccttagcagccgaa
attatcgagcgactcgcccaaggcaaatcactgacagatacaccagatttaacatctata
ttgacagaaattaatcaagcttgtgaacaggtgaatcaatggctgtttgcacaatctcaa
gaagcaattaaaaatggtaagcgcgttgcagtcattggtggcgatcacagttcaccatta
ggatatttccaggctttggcagcgagatacacaaactatgggattttgcacatcgatgca
catgcagatttacgcgatgcttatgagggatttgagttttcccatgcatcaatcatgttc
aatgccatgaaaataccacaaattactaaattagtgcaggtgggtttgcgcgatatttgt
catgatgaagtggaaataattgaccaatcaaatggtcgaattgtggcttattatgatcca
gcaattaaacaaaggctctattctggaagtacttggattaatttatgtcgagaaattatt
agtcatttacctgaatacgtttatattagttttgatgttgatggtctagatcctaaactc
tgtccaaatacaggtactcccgtcccagggggactagaattagaacaagctttttgttta
tttagggaattaattaatagcgatcgcaaaattattggctttgatgtctgcgaagttggt
gacgctgagtgggatggcaatgtcggggcgcggatagtttacaagctggcaaattttctc
gatttatctcagcaaggcaatagggaatag

DBGET integrated database retrieval system