KEGG   Calothrix sp. PCC 7507: Cal7507_5140Help
Entry
Cal7507_5140      CDS       T02358                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal7507_5140
Enzymes [BR:calo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cal7507_5140
Exosome [BR:calo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cal7507_5140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5831501..5833159
Genome map
AA seq 552 aa AA seqDB search
MPQPIEFKLFAPYNKGVALIGSFSDWQDLPMEKGEDGYFRTTVELEDGDYQYKFRVQSNS
WFFEPEQWVEVTDPYATDIDESSGKDNAIVRIKDGAKILDTYVWQHDDKPLPADHELVIY
ELHVGDFSGGEDDPYARGKYKHVIEKLDYLSDLGINAIELMPIKEYPGDYSWGYNPRHFF
ATESSYGSTDGLKRLIDECHNRGIRVIMDGIYNHSEASAPLTQIDHDYWYHHSPRDPDNN
WGPEFNYELYDEKLDTFPARKFIGETVRFWIEEYHIDGIRYDAARQIANYDFMHWIVQET
KKTAGNKPFYNVAEHIPETPSITNLDGPMDGCWHDSFLHTVLAHICGETFDLENLKDVID
AKRQGFLGATNVVNYLTNHDHEHIMVELANRNIFNEEAFRRAKLGGAILMTAVGVPLIWM
GEEFGEYKPKQPESSKIDWTLLGNELNSSLFEYYKGLVNLRKNSHALYTENIDFIHENLE
SKVLAYSRWNEEGSRVVVVANFSENFLAGYHVPNFPCGGTWHEWTSNYDVEAGEDGIITD
IGPYEAKVFVWQ
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgccacagccaatagaatttaagttatttgccccctataacaaaggagttgcattaatt
ggttctttttcagattggcaagatttacctatggaaaaaggtgaggatggctattttcgt
accactgttgaactagaagatggcgattatcaatataagtttcgtgtgcagtcaaactca
tggttttttgaaccagaacagtgggttgaggttacagacccttatgcaactgatatagac
gaatcgagtggtaaagataatgcgatcgtgcggattaaagatggggcaaaaattctcgat
acttatgtttggcaacacgatgataaacctctacccgccgaccatgaattagtaatttat
gaattgcatgtcggggatttttccggtggtgaagatgacccctatgcacgaggtaaatat
aaacacgtcattgaaaaattagattatttatctgacctgggaattaatgctattgagttg
atgccaataaaagaatatcccggtgactatagctggggttataatcctcgtcacttcttt
gcaactgaatcaagttatggttctacagatgggttaaagcgactaattgatgagtgtcat
aaccgaggcattcgtgtaattatggatggtatttacaaccactctgaagcttccgcacca
ttaacacaaattgaccacgattattggtatcaccactctcctcgtgaccctgataataat
tggggccctgagtttaattacgaactctacgacgaaaaattagatacgtttcctgcacgg
aaatttatcggtgaaacagtccgtttttggattgaagaatatcatatagatggtattcgc
tatgacgcagcgcgacaaattgccaactacgatttcatgcactggattgttcaagaaact
aaaaaaactgctggaaataagcctttttataatgtagccgaacatattccagaaacaccc
agcattaccaatttagacgggccaatggatggttgctggcatgatagtttcctccataca
gtgctagcacatatttgcggcgaaacttttgatttagaaaacctcaaggatgtcatagat
gctaaacgtcaaggcttcttgggtgcaaccaatgtggttaattacctcaccaatcacgac
catgagcatattatggtcgaactggctaatcggaatatttttaatgaagaagctttcagg
cgagctaaattaggaggagctattctgatgacagccgttggtgtaccattgatttggatg
ggtgaagaatttggtgagtataaacctaaacaacctgaatcatcaaaaatcgattggaca
ctactaggtaatgaattaaatagcagcttgtttgaatactataaaggcttagttaatttg
cgtaaaaatagtcatgcactttacacagagaatatcgattttattcacgaaaatctagaa
tctaaggtactagcctatagccgttggaacgaagaaggttctcgtgtggtagtggtagcc
aatttctcagaaaacttcctagctggttatcatgttcccaactttccttgtggtggtaca
tggcatgagtggacaagcaattatgatgtcgaagctggtgaagatggtatcataactgac
atagggccttatgaagcaaaagtattcgtttggcagtaa

DBGET integrated database retrieval system