KEGG   Calothrix sp. PCC 7507: Cal7507_5210Help
Entry
Cal7507_5210      CDS       T02358                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cal7507_5210
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Cal7507_5210
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Cal7507_5210
Lipid biosynthesis proteins [BR:calo01004]
 Desaturase
  First
   Cal7507_5210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5924814..5925653
Genome map
AA seq 279 aa AA seqDB search
MTAKFMASAPETGNSPRLSWTNVVFFTTFHALALLAPWFFSWTALGLLVFLHWLFGSIGI
CLGYHRLLSHRSFQVSKGVEYAIAFIGALALQGGPIFWVGGHRQHHAHTEDIDLDPYSAQ
RGFWWSHMLWIFYPRSQFFDYDTYQKYAPDLARQPYYRWLDRYFILLQIPLGLLLYALGG
WSFVIYGIFVRAVLLWHSTWFVNSATHKWGYRSFNANDGSRNLWWVSIVTYGEGWHNNHH
TYPHVAKAGFSWWEVDVTWWSIKALKTLGLAKKVVMPPS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaaatttatggcgtccgcccctgagacaggaaattcacctcgcctcagttgg
acaaatgtagtattttttactacatttcacgccttagctctattggctccctggtttttc
tcctggactgcattaggtttactggtgtttctccactggttatttgggagtattggtatc
tgcctaggatatcaccgtttactgagtcatcggagtttccaggtatccaaaggggtagaa
tatgcgatcgccttcatcggcgcactggctctccaaggggggccgattttctgggtaggt
ggacaccgccagcaccacgcccacactgaagatatcgatctagatccctactcagcccag
cgaggtttttggtggagtcacatgttatggattttctatcctcgttcccagttcttcgat
tatgacacctatcaaaaatatgctcctgacctagcgcgacaaccatattatcgctggctc
gatcgctattttatcctcctgcaaatacccttgggtctgctattgtatgctttaggtggc
tggtcttttgtcatctacggtattttcgtcagagcagtcttgctttggcactcaacttgg
ttcgtcaactctgcgacacacaagtggggctatcgctcctttaacgccaatgatggctct
cgtaatctttggtgggtatccatcgttacctacggtgaaggatggcacaataaccatcat
acttatccccacgtagccaaagctggcttttcttggtgggaagttgatgtcacttggtgg
agcattaaagctttgaagactttgggtttagccaaaaaggttgtcatgccaccctcttga

DBGET integrated database retrieval system