KEGG   Calothrix sp. PCC 7507: Cal7507_5327Help
Entry
Cal7507_5327      CDS       T02358                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00010  Glycolysis / Gluconeogenesis
calo00052  Galactose metabolism
calo00500  Starch and sucrose metabolism
calo00520  Amino sugar and nucleotide sugar metabolism
calo00521  Streptomycin biosynthesis
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
calo01120  Microbial metabolism in diverse environments
calo01130  Biosynthesis of antibiotics
calo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal7507_5327
   00052 Galactose metabolism
    Cal7507_5327
   00500 Starch and sucrose metabolism
    Cal7507_5327
   00520 Amino sugar and nucleotide sugar metabolism
    Cal7507_5327
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cal7507_5327
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cal7507_5327
Enzymes [BR:calo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cal7507_5327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFY35664
UniProt: K9PS74
Position
complement(6054813..6055736)
Genome map
AA seq 307 aa AA seqDB search
MCWCEYLKVVDSQVIGIDLGGTAMKLGRFSQDGTCLQSLTVATPQPATPKAVLAVMVDAI
AQIDPDDQAIAIGVGTPGPADARGRIAKIAINLPEWVDVPLADWLEAKTSKPTVVANDAN
CAGLGEAWLGAGRPFQNLILLTLGTGVGGAIILNGQLFVGHQGAAGELGLITSNPNGPKC
NSGNQGSLEQYTSVTAIRRRTGKEPAELGALAQVGDMEALTFWQEYGRDLGIGLVSLIYV
LTPEAVIIGGGVSASFEFFLPAVKAEIEQRVTPMSRVGLKILPAELGNSAGMLGAAKLAI
NQLTVNS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgtgttggtgtgagtatttgaaagtggtggattctcaggtaattggtattgatttgggg
ggaacagcgatgaagctgggaagattcagccaagatggtacttgtctgcaatctctgact
gtggcgactccccaaccagccacaccaaaggcggtgttggcggttatggtggatgcgatc
gcccaaattgatccagatgatcaagcaatagcgatcggtgtggggactcccggccctgct
gacgctagaggacgtattgccaaaattgctattaacttaccagaatgggttgatgtgcct
ttggcagattggttagaagccaaaactagtaagcccactgttgtggctaacgatgctaac
tgtgcaggtttaggagaagcttggttaggtgctggtcgtccctttcaaaatctgatattg
ttgaccttgggaactggtgttggtggagccattatcttgaatgggcaactatttgtggga
catcaaggtgccgctggagaattaggtttaatcacctctaaccccaatggccctaaatgt
aatagtggaaatcaaggttctttggaacagtacacctctgtcactgcaattcgtcgccgt
actggtaaggaacctgcagaattaggtgcccttgctcaagtgggagatatggaagcattg
acattttggcaagaatatggtagagatttgggtattggtttagtgagtttgatttacgtc
ctcacacctgaagcagtgattattggcggtggcgttagcgccagttttgaatttttttta
cctgcggtgaaggcagaaattgagcagcgagttacgcccatgtcgcgagtgggtttaaaa
atattaccagccgaattgggcaactctgcagggatgttaggtgcggcaaagttggcaatt
aatcagttaacagttaacagttaa

DBGET integrated database retrieval system