KEGG   Calothrix sp. PCC 7507: Cal7507_5462Help
Entry
Cal7507_5462      CDS       T02358                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
calo01130  Biosynthesis of antibiotics
calo01230  Biosynthesis of amino acids
Module
calo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cal7507_5462
Enzymes [BR:calo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cal7507_5462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NanE
Motif
Other DBs
NCBI-ProteinID: AFY35797
UniProt: K9PTB0
Position
complement(6201508..6202398)
Genome map
AA seq 296 aa AA seqDB search
MQIRRRSPSAVVNVSILQYQVAMPDAAPNNILEEIVWQKEIEDSQMRERLPLQELQKRVL
TAPPTRDFVAALREGKTKPALIAEVKKASPSKGVLRADFDPVAIALAYQKGGASCLSVLT
DVKFFQGSFENLALVRAAVDLPLLCKEFIIYPYQMYLARVQGADAVLLIAAILSDQDLQY
FVKIANTLNMAVLIEVHSLAELDRVLALDGVSLVGINNRNLADFSVDLQTTCQLLSARSK
QLQERNILVVSESGLHHPDDLSLVAQAGASAVLIGESLVKQPDPELAIAHILPKRS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgccgtcgttcacccagcgcagttgtgaatgtttccatattgcaatatcag
gttgctatgcccgatgcagcgccaaacaacatcttggaagaaattgtctggcaaaaagaa
atagaagatagccaaatgcgtgaaaggctaccgctgcaggaattgcaaaaacgggtactc
accgcaccaccaacccgtgactttgtggcagctttacgcgaaggtaagaccaaaccggca
ttaattgccgaagtcaaaaaagcttctcccagtaaaggggttttacgggcagattttgac
ccagtagcgatcgcacttgcctaccaaaaaggaggtgctagttgtctttctgtactgact
gatgtcaagttctttcaaggtagctttgaaaatttagccctagtccgcgctgccgtcgat
ttgccgctactgtgtaaggaatttatcatctatccctaccagatgtatttagcacgtgta
caaggggcagatgctgtgttattgattgcggctatcctcagcgatcaagatttgcaatac
tttgtcaaaattgctaacactttaaatatggcagtgttaatagaagtacacagcctagcc
gaacttgaccgtgtgttagccttagatggtgtatccctagtaggaattaataatcgcaat
ttagcagatttttccgttgacctgcaaacaacttgtcaactgctgtcggcaaggagtaag
caattgcaagaacggaatattttggttgttagtgagtcaggattacatcacccagatgac
ctgagtttagtggcgcaagcaggcgcatcagccgtactcattggcgagtctctagtgaaa
caaccagatccagaattagcgatcgcccatatattacccaagcgttcttga

DBGET integrated database retrieval system