KEGG   Calothrix sp. PCC 7507: Cal7507_5486Help
Entry
Cal7507_5486      CDS       T02358                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cal7507_5486
Enzymes [BR:calo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cal7507_5486
Exosome [BR:calo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cal7507_5486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6230523..6232049
Genome map
AA seq 508 aa AA seqDB search
MQTLGSTNQSSGYILALDLGTTGNRAFVFNAEGKIVANAYKELTQYYPQAGWLEHDPQEI
WQDTCSLMENAIAHAQISPTEIVALGLTVQRETCLIWDKTTGKPLHRAIVWQDRRTAPLC
HQLQAQGYTQEIYDRTGLIIDAYFSATKLRWLLDQFPDVDRHHLLAGTIDTWVLWNLTGG
RVHATDHSNASRTMLMNLQTCEWDENLLDLFQIPAHILPQIHPSLGKFGVTDAAVLGASI
PITAILGDQQAALFGHGCDRPGLMKCTYGTGSFLVAHTGNEVVRSQQQLISTVAWTQEQQ
SSKLDVGYALEGSMFTSGACIQWLRDGIKLITTAAETESMANQVPDNGGVYFVPAFSGLG
APYWDMSARGAFFGLTARVQPQHLVRAVLEAIAYQVAEVVQAINASTSTPMAQLTVDGGA
CENNFLMQFQADVLGIPVERPTIRDTTVQGAAFAAGLAVGFWHSYATLVQQRQIDRVFEP
SLDRHTALTNFATWQKAVKRTLTETVIS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacttggcagcacaaatcaatcatctggctacattttggcactggacttgggc
acaacagggaaccgagcgtttgtgtttaacgctgaaggcaagattgtggcaaacgcatat
aaagaactcacacagtattatccacaggctggatggttggagcatgacccgcaagaaatt
tggcaggatacttgctctttgatggaaaatgcgatcgctcatgctcaaatttccccgact
gagattgtcgctctgggattaaccgtgcagcgggaaacctgcttaatttgggacaaaact
acaggtaaaccactccatcgggcgatcgtttggcaagaccgccgcacggctcccttgtgt
catcagttacaagcacaaggctatacccaagagatttacgatcgcactggtttaattatt
gatgcctatttctctgctactaagttgaggtggttgttagatcagtttcccgatgttgac
cgtcaccacctcttagcagggacaattgatacttgggtgttgtggaatctcactggcgga
cgagtacacgccaccgaccacagcaacgccagccgcaccatgttgatgaatctccagacc
tgtgagtgggatgagaatttactggatctgttccagattcccgctcatatcttgccccag
attcaccccagcctgggaaaatttggcgtcacagatgcggctgtgctgggcgctagcatc
ccaattacggcaattttgggagatcagcaagcggctttgtttggtcatggctgcgatcgc
cctggtttgatgaaatgcacctacggcactggtagctttttggtggctcacactggtaat
gaagttgtacgatcacagcagcaactaatttcgacagtcgcatggacacaagagcaacag
agcagtaagttagatgtcggctatgccctagaaggcagtatgtttactagtggtgcttgt
atccaatggttacgcgatggcatcaaattaattaccactgccgccgaaactgaatctatg
gccaatcaagtcccagataacggaggagtatactttgtgccagcatttagcggactaggc
gcaccatactgggatatgagcgcgagaggagcttttttcggactgactgctagggtacaa
ccacagcatctggtacgcgccgttctggaagcgatcgcctaccaagtagcagaagtggtg
caagcgattaacgcatctactagcactccaatggcgcaattaaccgtagatggtggtgct
tgcgagaataattttctcatgcagttccaagcagacgtgttaggaattcccgttgaacgc
cccacgatccgcgacacaactgtgcagggtgccgcatttgcggcaggactagccgtagga
ttttggcatagttatgcaacactagtacagcaacggcaaatagaccgagtgtttgagcct
agtctagacaggcatactgcattgacaaacttcgccacttggcaaaaagcagttaaacgc
actctgactgaaacagttatcagttaa

DBGET integrated database retrieval system