KEGG   Calothrix sp. PCC 7507: Cal7507_5838Help
Entry
Cal7507_5838      CDS       T02358                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00040  Pentose and glucuronate interconversions
calo00052  Galactose metabolism
calo00500  Starch and sucrose metabolism
calo00520  Amino sugar and nucleotide sugar metabolism
calo01100  Metabolic pathways
calo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cal7507_5838
   00052 Galactose metabolism
    Cal7507_5838
   00500 Starch and sucrose metabolism
    Cal7507_5838
   00520 Amino sugar and nucleotide sugar metabolism
    Cal7507_5838
Enzymes [BR:calo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cal7507_5838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 HlyD_D4 Dynein_heavy
Motif
Other DBs
NCBI-ProteinID: AFY36152
UniProt: K9PUC4
Position
6627812..6628717
Genome map
AA seq 301 aa AA seqDB search
MQKNQVRKAVIPAAGFGTRLFPATKVVKKELFPIIDRDGRAKPVILAIAEEAISAGIAEV
AIVAQPEDEEIFTDLFKKPPKPELFQKLSPQNQEYSQYLQDLGSRVTILTQDAAEGYGHA
VFCAKDWVNNEPFLLMLGDHVYASDTEKSCARQVVDIYEQVNQSVIGLTTMPATIIHKAG
CVTGVWQELNLLLAVTQVSEKPTVEYARQHLRVAGMAEDEFLCVFGLYILVPKIFDFLAE
HINQDFRERGEFQLTSCLDRLRQAEGMTGYVVKGKCFDTGLPDAYRQTLIDFPANVATHL
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaatcaagttagaaaagctgtgattccggcggctggttttggtactcggtta
tttcccgccaccaaagttgtcaaaaaagagcttttcccgattattgatcgagatggtaga
gcaaaacccgtaattctggcgatcgcagaagaggcgattagtgcgggaattgcagaagta
gcgatcgtggcgcagccggaagacgaagaaatatttacagatttgtttaaaaaaccaccc
aaaccagaactattccagaaactttccccacagaatcaagaatacagccaatatcttcaa
gatttgggcagtagggtaacgatattaacgcaagacgcagcagaaggctacggacacgcc
gtattttgcgccaaagactgggtaaacaatgaaccatttttgctgatgctaggcgatcat
gtttacgcctctgacacggaaaaatcctgtgcccgtcaagttgtagatatttacgaacaa
gttaatcaaagcgttataggtttgactacaatgccagccacaatcattcacaaggctggg
tgtgtcacgggggtttggcaagagttaaatttgctgcttgcggtgacacaagtctccgaa
aagccaactgtggaatatgcacgccagcatctgcgtgtagccggtatggcagaagatgag
tttttatgtgtatttggtttatatatacttgtgccaaaaattttcgattttttggcagaa
cacattaatcaagactttcgtgaacggggagaatttcagttaacatcctgtcttgataga
ttgcgtcaagcagagggcatgacaggatatgtagttaaaggcaagtgttttgatacgggt
ttacctgatgcttatcgacagacattgattgattttccagccaatgtggctactcatctg
tcgtaa

DBGET integrated database retrieval system