KEGG   Calothrix sp. PCC 7507: Cal7507_5856Help
Entry
Cal7507_5856      CDS       T02358                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal7507_5856
Enzymes [BR:calo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cal7507_5856
Exosome [BR:calo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cal7507_5856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6646355..6648649
Genome map
AA seq 764 aa AA seqDB search
MSMTTIAPELVNRIVWNQHQDPFEVLGSHLVELNGKKVWAVRAYLPNASAAWVVLPQERK
EYAMETVHHPNFFECIIETAELTNYQLRIKEGEHERVTYDPYAFRSPNLTDFDLHLFGEG
NHHRLYEKLGAHPTDVDGVKGVYFAVWAPNARNVSLLGDFNNWDGRQHQMRKGATGVWEL
FIPEVGVGEHYKYEIKNFEGHIYEKSDPFGFQQEPRPKTASIVTDLNTYKWSDEDWLEKR
RHTDPLTQPVSVYEVHLGSWLHASSDEPAKLPNGETEAVVTVSELNPGARFLTYRELAER
LIPYVKELGYTHLELLPIAEHPFDGSWGYQVTGYYAPTSRFGTAEDFMYFVDQCHKNDIG
VIVDWVPGHFPKDGHGLAFFDGSHLYEHADPRKGEHKEWGTLVFNYSRHEVRNFLVANAL
FWFDKYHIDGIRVDAVASMIYNDYCRKEGEWLPNQYGGRENLDAADFLRQVNSLIFSYFP
GALSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKLANVRCLFSYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWHLFQYEPHQQLKQFFQDLNHLYRSEPTLYTQDFAQEGFEWIDCSD
NRHSVVSFIRRDRYSDDFAIVVCNFTPQPHSHYRIGVPEEGFYTELFNSDARKYGGSNMG
NLGGKWTDQWSLHNRPYSLDLCLPPLGVLVLKLDKVKTAEVIKS
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaccacgatcgctcctgaactggttaaccgtatcgtctggaatcaacatcaa
gatccctttgaagtactgggttctcatcttgtagaactgaatggcaaaaaagtatgggct
gtgagagcttacctaccaaacgccagtgcagcttgggtagttcttcctcaagaacggaaa
gaatatgcgatggaaacagtgcatcatcccaacttttttgaatgcattattgaaacagca
gaactgacaaattatcagttacggattaaagaaggcgaacacgagcgcgtcacttacgat
ccctacgccttccgttctcccaacctgactgactttgacttacatttgtttggtgaaggc
aatcatcaccgactttacgagaaattgggagcgcaccccacagacgtagatggtgtaaag
ggtgtttattttgctgtttgggcacccaacgcccgcaatgtttccttactaggagacttt
aacaactgggatgggcgacaacaccaaatgcgtaaaggtgccaccggcgtttgggaattg
ttcatccccgaagtgggcgtgggagagcattacaaatatgaaataaaaaattttgaagga
cacatttacgaaaaatccgatccttttggttttcagcaggaaccccgccccaaaacagca
tcaattgttactgatttaaatacctacaaatggagtgatgaagactggttagaaaagcgc
cgtcacactgaccccctcacccaaccagtgtcagtttatgaagtacatttaggctcttgg
ttacacgcatctagtgacgaacctgctaaattacccaatggtgaaactgaggccgtagtt
acggtttctgaactgaatccaggcgcacgcttcctcacctaccgggaattggcagaaaga
ctaattccctacgtcaaagaattaggttatacccatttggaactgttgcccattgcagag
catccctttgatggctcttggggttatcaagttactggttactatgctcccacctcccgt
tttggtaccgccgaggatttcatgtattttgttgaccaatgtcacaaaaatgatatcggc
gtgattgtggattgggttcctggacacttccccaaagatggacatggtttagctttcttt
gatggtagtcacttgtatgaacatgctgatccccgcaaaggtgaacacaaggaatggggg
actttagtattcaactattcccgccatgaagtgcgtaatttcttagtagcaaatgcgctg
ttctggtttgacaagtaccacattgatggaattcgcgttgacgctgtagcctcaatgatc
tacaacgactattgtcgtaaagaaggggaatggctacccaatcagtacggtggtagagaa
aacctagatgctgcggacttcttacgtcaagtaaattctctgatttttagctattttcct
ggcgcgctctccattgcggaggaatccacttcctggccgatggtttcttggcctacctac
acaggcggcttgggctttaacttgaagtggaatatgggctggatgcacgatatgctggac
tacttcagcatggacccctggttccgccagtttcaccaaaacaacatcacttttagcatg
tggtacaaccacagtgagaacttcatgctggctctgtcccacgatgaggtggtgcatggt
aagagtaatatcatcggcaaaatgccgggggatagatggcagaagttagctaatgtgcgt
tgtttgttttcttatatgtttgctcacccaggcaagaaaaccatgtttatgagcatggaa
tttggtcagtggagtgagtggaatgtctgggctgatttggaatggcatctattccagtat
gaaccacaccaacagttaaagcagtttttccaggatttaaaccatctctaccgctccgag
cctactttgtatacacaggactttgctcaggaagggtttgagtggattgattgtagcgac
aatcgccacagtgtggtttcgtttattcgccgcgatcgctattctgatgattttgcgatc
gtcgtttgtaacttcacaccccaaccccattcacattatcgcatcggtgtaccagaggaa
ggtttttatacagaattgttcaatagcgatgcccgcaaatatggcggtagcaatatgggc
aacttaggcggtaagtggacagatcaatggtcgttgcacaatcgtccctattcgctggat
ttgtgtctaccacctttgggtgtgttggttctcaagttggataaagtgaagacagcagag
gtaatcaagtcttaa

DBGET integrated database retrieval system