KEGG   Calothrix sp. PCC 7507: Cal7507_5921Help
Entry
Cal7507_5921      CDS       T02358                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:calo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6722576..6724615
Genome map
AA seq 679 aa AA seqDB search
MPTMPAPTITPKITAFPLTAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAI
YALLPPIEVVQGSISNCDPSHPETWDDRLLAEYADQDIQDVPTEIIPAPFIQIPLGVTED
RLLGSVDVEQSVKQGDTIFQPGLLATANRGVLYVDEINLLDDQISNQLLTVLSEGRNQIE
REGISFQHQCKPLFIATYNPEEGALREHLLDRIAIALSADGVLGLDQRVAAVEQAISYSL
SPQEFLQQYSEDLDGLKTQIILAREWLKDVTISREQIAYLVDEAIRGGVQGHRAELFAVR
VAKAAAALEGRNTVNAEDLRRAVELVIVPRATVVQTPPEQQAPPPPPPPPSPENQDEEQE
QEEQEEEKEQEEQQEQEPPSIPEEFIFDPEGVILDPSVLYFTQTAKRQGKSGSRSIIFSD
DRGRYIKPMLPKGKVRRIAVDATLRAAAPYQKARRERNPNKKVIVEQGDIRAKRLVRKAG
ALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVALIPFRGEQAEVLLPPTRSIA
LARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQVVLVAITDGRGNIPLARSLGE
QLEPGEKPDIKAELLEIAARIRALGIQLLVIDTESKFVSTGFAKELAQTAAGKYYHLPKA
SDKAIAAMTRGAIADLKSR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaatgcctgcgcctactattacccctaaaattactgcctttcccctgacagcc
gtagtcgggcaagaagcgattaaattagctttgttattagcagcggttgatccagaattg
ggaggagtagcgatcgcaggtcgtcgcggtacggcaaaatctgtaatggcgcgggctatt
tacgccctactaccacccattgaagttgtgcaaggctcaattagcaattgcgatcccagc
caccctgaaacatgggatgatcgattgttggctgagtatgcagatcaagatattcaagat
gtccccacggaaattatccccgcgccttttatccaaatccccctgggtgtgacagaagac
cgacttttgggttctgtggatgtggaacaatcagtcaaacaaggcgacacgatttttcag
cccgggttactcgctacagctaaccgaggcgttttgtatgtcgatgaaatcaacttgctg
gatgaccaaatcagcaatcagctgctaaccgtattatccgagggacgcaaccagattgag
cgggaagggatcagttttcagcatcagtgcaaacccctatttattgccacctataatccg
gaagaaggcgctttgcgagaacatttgcttgatagaattgcgatcgcactttcggctgat
ggtgtcctcggcttagatcaaagagtagcagctgtagaacaagccatctcttactcactc
tctccccaagaatttctccaacaatacagcgaagacttagacggactcaaaacccaaatc
atcctggcgcgggaatggttgaaagatgtcaccatcagtcgtgaacaaatcgcctatctc
gtcgatgaagccattcgtggcggcgtacaaggacatcgcgccgagttatttgcagtccga
gttgctaaagccgccgccgctttagaggggcgcaatacagtcaatgctgaagatttgcgt
cgggcggtggaattagtcattgtcccacgggcgacagttgtgcagacaccacccgaacaa
caagcaccaccaccgccaccacctcccccatcacctgaaaatcaagacgaagaacaggaa
caggaggaacaagaggaagaaaaagaacaagaagaacagcaagaacaagaaccacccagc
atcccagaagaatttatctttgatccggaaggggtaattcttgatcctagcgtgctttat
tttacacaaacagctaaacgccaaggcaagtctggtagtcgcagcattatcttttccgac
gaccggggacgctatattaagcctatgttgcccaaaggcaaggtacgacggatcgccgta
gatgccacattgagagccgcagccccgtatcaaaaagcacgtcgcgagagaaacccaaac
aaaaaagtcattgtcgaacaaggagacattcgtgccaaacgcctggtacgtaaagccggg
gccttggtgatatttgtggtagatgcttcaggttccatggccttaaaccggatgcagtca
gctaaaggcgcagtcatgcaacttttgactgaagcttatcagaaccgcgaccaagtcgca
ttgattcccttccggggagaacaagcggaggtgttattacctccaactcgttccattgct
ttggcacgtaaccgcctggaaagattaccttgtggtggtggttcacccttagcgcatggt
ttaacgcaagcagtgcgcgtcggcttaaatgctcaaatgagtggggatattgggcaagtt
gtgctagtagcaatcaccgacggacggggtaatattcccttggcacgttccttaggtgaa
cagctagaaccaggagaaaagccagatatcaaggcagaactattagaaattgccgctaga
ataagagctttaggaatacaactgttagtaatagatacggaaagtaaatttgtctctact
ggttttgctaaagaattagcacaaactgcagcaggcaaatattatcatctgccgaaagcg
agtgataaagctattgctgctatgactagaggtgcgatcgctgatctaaaatcacggtaa

DBGET integrated database retrieval system