KEGG   Calothrix sp. PCC 6303: Cal6303_0291Help
Entry
Cal6303_0291      CDS       T02372                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:calt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cal6303_0291
Enzymes [BR:calt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cal6303_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341798..344047
Genome map
AA seq 749 aa AA seqDB search
MSSAYQANQPSSNAAPNQESITGVVERLTFHSEESGYTVARLQRPRVSELTTITGSFAGI
QPGQTLELNGFWHEHPQYGSQFQVVNYKETKPATITGIEKYLGSGLIKGVGPVTAKRIVA
HFGVETLDIIENQIDRLHEVNGIAKKRIAMIQKAWNEQKAIKEVMIFLQTHGVSTVYAVK
IYKNYGDKSIGIVTNNPYQLATDIYGIGFLTADKIARNLGVPEDSEFRYRAGITHILNEA
SEDGHCYLPQPELIEKVSQCLKTDDHQPNEDAIAQIIKNMSLADELIREISPDKTLLCYN
PAFFNTENNLALLIAQRLRSPINPDMQRVRTWLARFTKSRKVELSPQQQEAVEMAAYSPI
SILTGGPGTGKTFSVRTIVELWKAMGKSIALAAPTGRAAQRLTEMTGLEAKTVHRLLEFD
PKNMGFKRDMKNPLPQKAIIIDEASMLDLFLAYSLIKAISEDSQILVVGDNDQLASVGPG
KVLADLMNSGKVPVVRLTQIFRQAQTSAIIRSAHQINLGQYPNIEPISETPQSDCLWHGG
GQQPEHGVQAISELITDFIPSLGFNPAIDVQVLSPMTRGLVGTRNLNNVLQQLINPPSPQ
KLEVTRGGTVFRVGDRVIQLTNDYNREVFNGDVGFITNIDTEEQEVIVQYQDRDVTYDYA
DLNELALAWSVTIHKSQGSEYRVAIMPLYTQHYMMLSRNLIYTGLTRAKELAIIVGSKKA
IGMAVRSVNQKERYTQLRERLAQISTISS
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgcgtaccaagctaaccaaccatcaagtaatgccgctcccaaccaagaatca
atcacgggggtggtagaacgtttgacttttcattccgaggagtcgggttatacggtagcg
cggttgcaacgtcccagggtatcagaattaactacaatcactggtagctttgcaggcatt
caacccggacaaacacttgaattaaatggcttttggcacgaacacccccaatatggttcg
caattccaggttgttaactacaaagaaactaaaccagccacaatcacgggaatcgaaaag
tatttaggtagcggcttaattaaaggagttggtcccgttacagccaaaagaattgtcgcc
cattttggcgtggaaacgttggatatcatcgaaaaccaaattgatcgcttgcatgaagtc
aacggcatcgccaagaagcgaattgccatgattcaaaaagcctggaacgagcaaaaagcc
atcaaagaagtaatgatatttttgcaaacacatggcgtttccactgtctatgcagtcaaa
atctataaaaattatggggataaatctattggaatagtcacaaataacccgtaccaactg
gcaaccgatatttacggcattggcttcctcaccgcagataaaattgcccgtaacttggga
gtccctgaagattccgaatttcgctatcgtgctgggattacccatatattaaatgaagca
tcggaagacgggcattgctatttaccgcaacccgaattgatagagaaagtatcccaatgt
ctcaaaaccgatgatcatcaaccaaacgaggatgcgatcgcacaaatcatcaaaaatatg
tccctcgcagacgaactaattcgggaaatctctcccgataaaacgttactttgctacaac
cctgcatttttcaatactgagaacaacttagcattgctaattgcccagcgtttaagaagc
cccatcaatccagacatgcaacgtgtccgcacatggcttgcacgctttaccaaaagtcgc
aaagttgaactttcaccccaacaacaagaagcagtcgagatggcagcatattcacctatc
tcgattttaactggtggaccaggaacggggaagacctttagtgtgcggactattgtggaa
ctgtggaaggcgatgggaaaatcaattgccctcgcagcacctactggacgagcagcacaa
cgattaactgaaatgacgggattggaagcaaaaaccgtacatagattgctggagtttgac
cccaagaatatgggtttcaagagggatatgaaaaatcccctgccacagaaagcaattatc
atcgatgaggcaagtatgttggatttgtttttggcatacagtttaatcaaagctatatcc
gaagacagccaaattctggtggttggtgataatgatcagctggcttccgttggaccaggc
aaggtgcttgcagatttaatgaattcgggaaaagtacccgtagtacgtcttactcaaata
tttcgccaagctcaaacaagtgcgattattagaagtgctcaccaaatcaaccttggacaa
tatcccaatatcgagccaatttccgagactcctcaatctgattgtttgtggcatggtggt
gggcaacaaccagaacatggtgtccaagcaattagtgagttgataacagattttattcct
tcccttggttttaatcctgccatcgatgtgcaagtattatcgccaatgacacgggggttg
gtgggtacacgcaatctcaataatgtgttgcagcagttaattaatcccccaagtccacag
aagctagaggttacgaggggtgggacagtttttcgagttggggacagggtgattcaactt
accaacgattacaaccgcgaagtattcaatggtgatgtcggatttattaccaacattgac
actgaagaacaggaggtcatcgtacagtatcaagatagggatgtaacctatgactacgca
gatttaaacgaacttgctttggcttggagcgttactattcacaaatctcaaggttccgaa
tatcgagttgcaattatgcccctgtatactcagcactatatgatgctttcgcgtaactta
atttatacaggattaactcgtgcgaaggaattagcaattattgtcggttccaaaaaggcg
attgggatggctgtcaggtcggttaatcagaaggaacggtatacccaactgcgggaaaga
ttggctcaaatttcaacaatttcatcatga

DBGET integrated database retrieval system