KEGG   Calothrix sp. PCC 6303: Cal6303_0611Help
Entry
Cal6303_0611      CDS       T02372                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:calt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cal6303_0611
Enzymes [BR:calt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cal6303_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717031..717660
Genome map
AA seq 209 aa AA seqDB search
MISYLKGIIAGIQSSGNRHTLTLEVNGMGYDLQVPGKLATHLPGSGETVQVFTHYQVREE
IPLLYGFGSPSERDLFRHLLAVSGIGAALAIALLDTLEVPELVQAIVTNNVQLLIQAPGV
GKKTGERICLELKSKLIEWRKTAGFFVATGGPAPGILDEVQSTLLALGYTASEVSHALHY
VSEDIGLPKDAYVEDWIRQSIAHLSSTEV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattagttatcttaaaggaattattgctgggattcaaagtagtggtaatcgtcatacc
ctcaccttggaagtgaacggtatgggttatgatttgcaggttcccggaaagttggcaaca
catttacctggttctggggaaactgtccaagtttttacccattaccaagttcgtgaggaa
attccccttttatacggttttggctcaccttcggaacgagacttatttcggcaccttttg
gctgttagtggcattggtgcagctttagcgatcgcattactggatacgctggaggtaccg
gagttagtacaggcaattgtcacaaacaatgtgcaattactgatccaagcaccaggagtc
ggcaagaagacgggtgaacgcatctgtttggaactgaagagtaaacttattgaatggcgc
aaaacagcggggttcttcgtcgctacaggtggtcctgcacctggtatcctagatgaagtt
caaagtaccctcttagctttaggctacaccgctagtgaagttagtcacgctctacattat
gtcagcgaggatattggtttacctaaagatgcttatgtagaggattggattcgccaatct
atcgctcacctgagtagcactgaggtttaa

DBGET integrated database retrieval system