KEGG   Calothrix sp. PCC 6303: Cal6303_0998Help
Entry
Cal6303_0998      CDS       T02372                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:calt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1178784..1180271)
Genome map
AA seq 495 aa AA seqDB search
MGYILALDLGTTGNRAFIFDINGKVIAQAYRELAQYYPQPGWLEHNPQEIWQDTCWVMEH
AIKNAQINPDEIVAIGLTVQRETCLLWDKTTGEPLYNAIVWQDRRTAAFCQQLQEKDNAD
LIYERTGLVLDAYFSASKLRWLLDQCQDVHLNNILAGTIDTWILWKLTEGKVHATDHSNA
SRTMLMNLATCQWDSQLLELFQVPIEILPQIQPSFSEFGFTSTAILGVPIPITAVLGDQQ
ASLFGHNCTSPGLMKCTYGTGSFLVANTGNQIIRSGQKLISTLAWTQVKNHQLQINYALE
GSMFTAGACIQWVRDRLKLIATAAESEIMANQVTDNGGVYFVPAFSGLGAPHWDMDVRGA
FWGLTGGVQSQHIVRSVLEAIAFQVKEVVQAIETSSSIPVQQLAVDGGACENNFLMQLQA
DILGIPVERPVMRDTTVQGIAFAAGLRVGFWDSDEVLLSQRQIERIFEPRQEQNKVLDDF
HRWQKAVELTKSWQN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggatatattctggcgttagatttgggcacaactggaaatagggcgtttatatttgat
atcaatggtaaagttatcgcccaagcatacagggaattggcgcagtattatccccaaccg
ggctggttagaacataatccccaagagatttggcaggatacttgttgggtgatggaacat
gctattaaaaatgcccaaattaacccagatgaaattgttgctatcggtttaacggtacag
cgggaaacctgtttactgtgggataaaaccaccggagaaccgctgtataatgccattgtt
tggcaagatagacgtacagcagctttttgtcagcaactccaggaaaaagataatgcagat
ttgatatacgaacgcactggcttggtacttgatgcttatttttcggctagcaagttaaga
tggttactagatcaatgtcaagatgttcatctcaacaatatattggctggaacaatcgat
acttggatactctggaaacttactgagggtaaagtccacgctaccgaccatagcaatgct
agccggacgatgttaatgaatttggctacctgtcaatgggattcacaattgttggagtta
tttcaggtacctatagagatattgccgcagattcaaccaagttttagtgaatttggattt
actagtactgcaatactaggagtaccaattcccatcaccgcagtattgggagatcagcaa
gcctctttattcggtcacaattgtactagtcccggtttaatgaaatgcacctacggaact
gggagttttttggtagcaaatacagggaatcagattattcgttctggacaaaagttaatt
tctactttggcatggactcaagtcaaaaatcaccagttgcaaattaactatgctttggaa
gggagcatgtttacagcgggagcatgtattcagtgggtacgcgatcgcttaaaattaata
gcgactgctgctgaaagcgaaattatggcaaaccaagttactgataacggcggcgtatat
tttgtaccagcattcagcggactaggggcaccccattgggatatggatgtgcggggggca
ttttggggacttacaggtggtgtacaatcacagcatatagtgcgttccgtcttagaagcg
atcgcgttccaagtcaaagaggtagttcaagcgatagaaacatccagttccatccccgtg
caacaactagctgtagatggtggcgcttgtgaaaacaattttttgatgcagctacaagcg
gatattttgggaattcctgtagaacgtcccgttatgcgtgatactaccgttcagggtata
gcatttgccgctggattaagagtgggattttgggatagcgatgaagttttgctttcccaa
cggcaaattgaacgaatatttgaacccagacaggaacaaaataaagttctagatgatttt
caccgctggcaaaaagcagttgaattaactaaatcttggcaaaattga

DBGET integrated database retrieval system