KEGG   Calothrix sp. PCC 6303: Cal6303_0998Help
Entry
Cal6303_0998      CDS       T02372                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cal6303_0998
Enzymes [BR:calt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cal6303_0998
Exosome [BR:calt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cal6303_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1178784..1180271)
Genome map
AA seq 495 aa AA seqDB search
MGYILALDLGTTGNRAFIFDINGKVIAQAYRELAQYYPQPGWLEHNPQEIWQDTCWVMEH
AIKNAQINPDEIVAIGLTVQRETCLLWDKTTGEPLYNAIVWQDRRTAAFCQQLQEKDNAD
LIYERTGLVLDAYFSASKLRWLLDQCQDVHLNNILAGTIDTWILWKLTEGKVHATDHSNA
SRTMLMNLATCQWDSQLLELFQVPIEILPQIQPSFSEFGFTSTAILGVPIPITAVLGDQQ
ASLFGHNCTSPGLMKCTYGTGSFLVANTGNQIIRSGQKLISTLAWTQVKNHQLQINYALE
GSMFTAGACIQWVRDRLKLIATAAESEIMANQVTDNGGVYFVPAFSGLGAPHWDMDVRGA
FWGLTGGVQSQHIVRSVLEAIAFQVKEVVQAIETSSSIPVQQLAVDGGACENNFLMQLQA
DILGIPVERPVMRDTTVQGIAFAAGLRVGFWDSDEVLLSQRQIERIFEPRQEQNKVLDDF
HRWQKAVELTKSWQN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggatatattctggcgttagatttgggcacaactggaaatagggcgtttatatttgat
atcaatggtaaagttatcgcccaagcatacagggaattggcgcagtattatccccaaccg
ggctggttagaacataatccccaagagatttggcaggatacttgttgggtgatggaacat
gctattaaaaatgcccaaattaacccagatgaaattgttgctatcggtttaacggtacag
cgggaaacctgtttactgtgggataaaaccaccggagaaccgctgtataatgccattgtt
tggcaagatagacgtacagcagctttttgtcagcaactccaggaaaaagataatgcagat
ttgatatacgaacgcactggcttggtacttgatgcttatttttcggctagcaagttaaga
tggttactagatcaatgtcaagatgttcatctcaacaatatattggctggaacaatcgat
acttggatactctggaaacttactgagggtaaagtccacgctaccgaccatagcaatgct
agccggacgatgttaatgaatttggctacctgtcaatgggattcacaattgttggagtta
tttcaggtacctatagagatattgccgcagattcaaccaagttttagtgaatttggattt
actagtactgcaatactaggagtaccaattcccatcaccgcagtattgggagatcagcaa
gcctctttattcggtcacaattgtactagtcccggtttaatgaaatgcacctacggaact
gggagttttttggtagcaaatacagggaatcagattattcgttctggacaaaagttaatt
tctactttggcatggactcaagtcaaaaatcaccagttgcaaattaactatgctttggaa
gggagcatgtttacagcgggagcatgtattcagtgggtacgcgatcgcttaaaattaata
gcgactgctgctgaaagcgaaattatggcaaaccaagttactgataacggcggcgtatat
tttgtaccagcattcagcggactaggggcaccccattgggatatggatgtgcggggggca
ttttggggacttacaggtggtgtacaatcacagcatatagtgcgttccgtcttagaagcg
atcgcgttccaagtcaaagaggtagttcaagcgatagaaacatccagttccatccccgtg
caacaactagctgtagatggtggcgcttgtgaaaacaattttttgatgcagctacaagcg
gatattttgggaattcctgtagaacgtcccgttatgcgtgatactaccgttcagggtata
gcatttgccgctggattaagagtgggattttgggatagcgatgaagttttgctttcccaa
cggcaaattgaacgaatatttgaacccagacaggaacaaaataaagttctagatgatttt
caccgctggcaaaaagcagttgaattaactaaatcttggcaaaattga

DBGET integrated database retrieval system