KEGG   Calothrix sp. PCC 6303: Cal6303_1048Help
Entry
Cal6303_1048      CDS       T02372                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00040  Pentose and glucuronate interconversions
calt00052  Galactose metabolism
calt00500  Starch and sucrose metabolism
calt00520  Amino sugar and nucleotide sugar metabolism
calt01100  Metabolic pathways
calt01130  Biosynthesis of antibiotics
Module
calt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cal6303_1048
   00052 Galactose metabolism
    Cal6303_1048
   00500 Starch and sucrose metabolism
    Cal6303_1048
   00520 Amino sugar and nucleotide sugar metabolism
    Cal6303_1048
Enzymes [BR:calt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cal6303_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFZ00111
UniProt: K9UX21
Position
complement(1230777..1231664)
Genome map
AA seq 295 aa AA seqDB search
MPANRIRKAVIPAAGFGTRLFPSTKVVKKELFPIIDRDGRAKPVILLIIEEAIKAGIEEV
AIIVQPDDKKIFKTLFKRPPSAELFEKLSPENQVFSKYLVDLGDRITILTQDRQEGYGHA
VYCAKKWVGDEAFLLMLGDHIYTSYGEKSCAAQILNIFNQVNQSVIGLTKVTSESLHQVG
CVTGIWQQQKDVLSVTQIAEKPSIDYAHQNLRMDGLCEDEFLSIFGLYALTPTIFDCLEQ
DIQNNKRMKGEFQLTTCLDSLRQIESMTGYFVNGKCFDIGLPSAYLQTLIDFKNR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaatagaattagaaaagcagtgattcccgcagcaggttttggcacaaggtta
tttcccagtaccaaagttgttaaaaaagaactttttcccattattgatcgagatggcaga
gccaaacctgtaattttattaattattgaagaagcaattaaagctggaattgaagaagtt
gcaattattgttcaaccagatgataaaaagatattcaaaaccttatttaaaagaccaccc
agtgccgaactttttgaaaaactatcccctgaaaatcaagtatttagtaagtatttagta
gatttgggcgaccgaatcacaattttaactcaagaccggcaggaaggttacggacatgct
gtctactgtgccaaaaaatgggttggagatgaagcatttttattaatgttaggcgaccat
atatatacatcttacggtgaaaaatcctgcgctgctcaaattttgaatatttttaatcaa
gttaatcagagtgtaattggtttaactaaagttacatctgaatcattacatcaggttggt
tgtgtcactggtatttggcaacagcaaaaagatgtactttccgtcacccaaatagcagaa
aaaccatccattgattacgcacatcaaaatttaaggatggatggactttgtgaagatgag
tttttaagtatttttggattatatgcactaaccccgacaatttttgattgtttagaacaa
gatattcagaataacaagcggatgaaaggtgaatttcagttgactacttgtttagatagc
ttgcgtcaaatagaatcaatgacgggttattttgtgaatggaaaatgttttgatatcggt
ttacctagtgcttatttacagactttaatagattttaaaaatcgataa

DBGET integrated database retrieval system