KEGG   Calothrix sp. PCC 6303: Cal6303_1048Help
Entry
Cal6303_1048      CDS       T02372                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cal6303_1048
   00052 Galactose metabolism
    Cal6303_1048
   00500 Starch and sucrose metabolism
    Cal6303_1048
   00520 Amino sugar and nucleotide sugar metabolism
    Cal6303_1048
Enzymes [BR:calt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cal6303_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1230777..1231664)
Genome map
AA seq 295 aa AA seqDB search
MPANRIRKAVIPAAGFGTRLFPSTKVVKKELFPIIDRDGRAKPVILLIIEEAIKAGIEEV
AIIVQPDDKKIFKTLFKRPPSAELFEKLSPENQVFSKYLVDLGDRITILTQDRQEGYGHA
VYCAKKWVGDEAFLLMLGDHIYTSYGEKSCAAQILNIFNQVNQSVIGLTKVTSESLHQVG
CVTGIWQQQKDVLSVTQIAEKPSIDYAHQNLRMDGLCEDEFLSIFGLYALTPTIFDCLEQ
DIQNNKRMKGEFQLTTCLDSLRQIESMTGYFVNGKCFDIGLPSAYLQTLIDFKNR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaatagaattagaaaagcagtgattcccgcagcaggttttggcacaaggtta
tttcccagtaccaaagttgttaaaaaagaactttttcccattattgatcgagatggcaga
gccaaacctgtaattttattaattattgaagaagcaattaaagctggaattgaagaagtt
gcaattattgttcaaccagatgataaaaagatattcaaaaccttatttaaaagaccaccc
agtgccgaactttttgaaaaactatcccctgaaaatcaagtatttagtaagtatttagta
gatttgggcgaccgaatcacaattttaactcaagaccggcaggaaggttacggacatgct
gtctactgtgccaaaaaatgggttggagatgaagcatttttattaatgttaggcgaccat
atatatacatcttacggtgaaaaatcctgcgctgctcaaattttgaatatttttaatcaa
gttaatcagagtgtaattggtttaactaaagttacatctgaatcattacatcaggttggt
tgtgtcactggtatttggcaacagcaaaaagatgtactttccgtcacccaaatagcagaa
aaaccatccattgattacgcacatcaaaatttaaggatggatggactttgtgaagatgag
tttttaagtatttttggattatatgcactaaccccgacaatttttgattgtttagaacaa
gatattcagaataacaagcggatgaaaggtgaatttcagttgactacttgtttagatagc
ttgcgtcaaatagaatcaatgacgggttattttgtgaatggaaaatgttttgatatcggt
ttacctagtgcttatttacagactttaatagattttaaaaatcgataa

DBGET integrated database retrieval system