KEGG   Calothrix sp. PCC 6303: Cal6303_1432Help
Entry
Cal6303_1432      CDS       T02372                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cal6303_1432
   00330 Arginine and proline metabolism
    Cal6303_1432
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Cal6303_1432
Enzymes [BR:calt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Cal6303_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1685413..1686396)
Genome map
AA seq 327 aa AA seqDB search
MKNAGDVETGLSSFEEFLGELYHKYKSLRDGTVANYIPELAKVNPELFSICIVTADGRVY
EVGDRTHLFTIQSISKVLVYGLALEDRGRDYMLTRVGVEPTGDAFNAIILDELSKRPYNP
MVNAGAIATTSLIKGTGATERLNRLLDMYRRYVGHDVFVDISVFTSERSTGHRNRAMAHL
MLNFGMIDVHIEEALDLYFQQCAVMVNCRDLAVMAATLANRGINPITGEKAVDSTYIKDI
LSVMYTCGMYNFAGEWAYKIGIPAKSGVSGGIIAVIPGYMGIAVFSPLLDSRGNSVRGVK
VCEELSHKFGLHMFDCVQRNLESIPES
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaggagatgtagaaacaggtttatcaagctttgaggagtttttgggggaa
ttgtatcataagtataaatcgctgcgtgatggtacagttgccaactacattcctgaacta
gctaaggtgaatccggaattatttagtatttgtattgtgacggcagatggtagggtttac
gaagtaggcgatcgcactcacctatttaccatccaatctatatcaaaagtcttggtatat
gggttagctttggaagataggggtcgagattatatgttgacgcgggtgggagtggaaccc
actggagacgcattcaacgcaattatcttggatgagttgtccaaacgaccctataatccc
atggtaaatgcaggcgcgatcgctacaacgagtttaatcaagggtacaggtgcaaccgaa
cgtctcaaccgcttattagacatgtaccgccgctacgtagggcatgatgtattcgttgac
atctcagtatttacctccgaacgcagcaccggacaccgcaaccgggcgatggcacatttg
atgctgaattttggtatgattgatgtccatatcgaagaagctttagatctatactttcaa
caatgtgcagtcatggtcaactgtcgtgacttagcagtcatggctgcaactttggcaaac
agagggattaacccgataacgggggaaaaggcagttgatagtacctacattaaggatatt
ctcagcgtgatgtacacctgtggaatgtacaattttgctggagaatgggcatataaaatc
gggattccggcaaaaagtggtgttagcggcggaattatcgccgtaattcccggatatatg
gggattgccgtattttcaccactgttagattcacggggtaacagcgtccgtggggtgaag
gtatgcgaagaactatcacataaatttggattacacatgtttgattgtgtacaacgcaac
ctggaaagtattcctgagtcttga

DBGET integrated database retrieval system