KEGG   Calothrix sp. PCC 6303: Cal6303_1636Help
Entry
Cal6303_1636      CDS       T02372                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cal6303_1636
Enzymes [BR:calt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cal6303_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1932314..1933363
Genome map
AA seq 349 aa AA seqDB search
MIMNNPSTDYNPSGVGQANGNLFGLPFNYDSASLIVFSVPWEVTVSYGAGTANAPQQILD
ASPQLDLFDFDHPDGWKQGIFMAEISPDLLTKNKHYRQQAAKIIERLEQGKLLTDTPDLT
SLLTEINQTCQQVNQWLFDKCQQAISQGKRVAVIGGDHSSPLGYFQALATKYPDFGILHI
DAHADLRDAYEGFEFSHASIMFNAMKIPQISKLVQVGLRDICQDEVDIINQSNQRIVAYY
DSLIQQKIYGGTTWIEMCREIISHLPEYVHISFDVDGLDPKLCPNTGTPVPGGLELEQSF
CLFREVVNSGRKIIGFDLCEVGDAEWDGNVGARIVLKLANLLDLSQKSR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaataatccttccacagattataatcctagtggtgttggtcaagcaaatggg
aacctttttggtttgccattcaattatgactctgcaagcttaatagtttttagcgtaccg
tgggaagtcacagtatcctacggtgcgggtactgcaaatgcacctcaacaaattttagat
gcttccccacaactagatttatttgatttcgatcatcctgatggttggaagcaggggata
tttatggcggaaatttctccagatttacttaccaagaataaacattaccgtcagcaagca
gcaaaaattattgagcgattagaacaaggcaaattactgacagatacaccagatttaaca
tcactgctaacagaaattaatcaaacttgccagcaggtaaatcaatggttatttgacaaa
tgtcaacaagcaattagtcaaggtaaaagagtcgctgtaattggaggagatcatagttct
cctttgggctatttccaagcattagcgacaaagtacccagattttggcatcttacacatt
gatgcacatgctgatttgcgggatgcttatgagggatttgagttttcccatgcttccatt
atgtttaatgccatgaaaatacctcaaatttccaagttagttcaggtaggattacgggat
atttgtcaagatgaagtagacataattaatcaatcaaatcagcgaatagttgcttactat
gactccctaattcaacaaaaaatctacgggggaacaacctggattgagatgtgcagagag
atcatttcccatcttccagaatacgttcatatcagctttgacgttgatggattagatcct
aaactttgtccaaatactggtacacccgttcccggtggattggagttggaacaaagcttt
tgtttatttcgagaagtagttaatagtggcagaaagattattggttttgatctgtgtgaa
gttggtgacgctgagtgggatggaaacgtaggtgcgagaattgtcttgaaactagctaat
ttattggatttatcacaaaaatcaagataa

DBGET integrated database retrieval system