KEGG   Calothrix sp. PCC 6303: Cal6303_1636Help
Entry
Cal6303_1636      CDS       T02372                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:calt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1932314..1933363
Genome map
AA seq 349 aa AA seqDB search
MIMNNPSTDYNPSGVGQANGNLFGLPFNYDSASLIVFSVPWEVTVSYGAGTANAPQQILD
ASPQLDLFDFDHPDGWKQGIFMAEISPDLLTKNKHYRQQAAKIIERLEQGKLLTDTPDLT
SLLTEINQTCQQVNQWLFDKCQQAISQGKRVAVIGGDHSSPLGYFQALATKYPDFGILHI
DAHADLRDAYEGFEFSHASIMFNAMKIPQISKLVQVGLRDICQDEVDIINQSNQRIVAYY
DSLIQQKIYGGTTWIEMCREIISHLPEYVHISFDVDGLDPKLCPNTGTPVPGGLELEQSF
CLFREVVNSGRKIIGFDLCEVGDAEWDGNVGARIVLKLANLLDLSQKSR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaataatccttccacagattataatcctagtggtgttggtcaagcaaatggg
aacctttttggtttgccattcaattatgactctgcaagcttaatagtttttagcgtaccg
tgggaagtcacagtatcctacggtgcgggtactgcaaatgcacctcaacaaattttagat
gcttccccacaactagatttatttgatttcgatcatcctgatggttggaagcaggggata
tttatggcggaaatttctccagatttacttaccaagaataaacattaccgtcagcaagca
gcaaaaattattgagcgattagaacaaggcaaattactgacagatacaccagatttaaca
tcactgctaacagaaattaatcaaacttgccagcaggtaaatcaatggttatttgacaaa
tgtcaacaagcaattagtcaaggtaaaagagtcgctgtaattggaggagatcatagttct
cctttgggctatttccaagcattagcgacaaagtacccagattttggcatcttacacatt
gatgcacatgctgatttgcgggatgcttatgagggatttgagttttcccatgcttccatt
atgtttaatgccatgaaaatacctcaaatttccaagttagttcaggtaggattacgggat
atttgtcaagatgaagtagacataattaatcaatcaaatcagcgaatagttgcttactat
gactccctaattcaacaaaaaatctacgggggaacaacctggattgagatgtgcagagag
atcatttcccatcttccagaatacgttcatatcagctttgacgttgatggattagatcct
aaactttgtccaaatactggtacacccgttcccggtggattggagttggaacaaagcttt
tgtttatttcgagaagtagttaatagtggcagaaagattattggttttgatctgtgtgaa
gttggtgacgctgagtgggatggaaacgtaggtgcgagaattgtcttgaaactagctaat
ttattggatttatcacaaaaatcaagataa

DBGET integrated database retrieval system