KEGG   Calothrix sp. PCC 6303: Cal6303_1751Help
Entry
Cal6303_1751      CDS       T02372                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:calt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2093189..2095216
Genome map
AA seq 675 aa AA seqDB search
MPASTAPSITAFPLAAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALL
PPIEVMKGSISNCDPNHPEDWDDLLLEDTPNVEGNTEIIPAPFIQIPLGVTEDRLLGSVD
VEKSVKEGDTVFQPGLLAAANRGVLYVDEINLLDDQISNQLLSVLSEGRNQIEREGISFQ
HPCKALFIATYNPEEGGLREHLLDRIAITLSADGVMGVDQRVEAVEQAISYSRSPQDFLE
QYDEDIDALKTQIILAREWLKEVKISHEQIAYLVDEALRGQVQGHRAELFAVRVAKAAAA
LEGRNQVTPEDLKRAVELVIVPRATVIQTPPEESPPPPPPPPQNQEEPEDESEQEQEEEE
QEENEDQDEPEQEPPGIPEEFIFDPEGVILDPSVLYFAQMSQRQGKSGSRSIILSEDRGR
YIKPMLPKGKVKRIAVDATLRAAAPYQKSRKERQPNRKVVVEPGDMRAKRLVRKAGALII
FLVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVSLIPFRGEQAEVLLPPTRSIAMAKN
RLERLPCGGGSPLAHGLTQAVRVGVNAQMSGDIGQVVIVAITDGRGNIPLSRSLGEPQDP
DNKPDIKAELLDIAARIRAMGMQLLVIDTESKFVSTGFAKELAKTSGGKYYHLPKATEQA
IAAMTRGAIADIKSR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgtccactgctccaagtattacagctttccctttggctgccgtagtcggtcag
gaagcgattaaaatagccttattactcgcagccgtagatccgggtttgggaggagttgcg
atcgcaggtcgtcgcggtacggcaaaatctgtgatggcacgcgctattcatgcccttcta
ccccccatcgaagtgatgaagggttccattagtaattgtgaccctaatcacccagaagat
tgggatgatttgcttttagaagatacccccaatgtagaaggaaatacagaaattattccc
gcaccttttattcagattcctctaggtgtcaccgaggatcggttattaggttcggttgat
gtggaaaaatcagtcaaagaaggtgacacagtattccaacctgggttactggctgcggca
aatcgaggtgtgttgtatgtggatgaaatcaacctcctggatgaccaaattagcaaccag
ttattaagcgtactctccgaaggacgcaaccaaattgaacgggaaggaatcagcttccaa
cacccctgcaaagccttatttattgccacctacaaccccgaagaagggggattacgggaa
cacctacttgacagaatcgccattactctctccgcagatggtgtcatgggtgtagatcag
cgcgttgaagctgtggaacaagcaatttcctactcccgttccccccaagactttttggaa
cagtacgacgaagatattgacgcactcaaaactcaaattattttggcgcgagaatggctc
aaagaagtcaaaatcagccacgaacaaatagcatatttagttgatgaagcattgcgggga
caggtgcagggacaccgcgccgagctttttgcagtgcgtgtcgccaaagctgcggcggct
ttggaaggacggaaccaagttacccccgaagatttgaagcgtgccgtggaattagtaatt
gtaccgagggcaacggtaattcagacacctccagaggaatcaccaccaccccctccccca
ccaccacagaatcaggaagaacctgaagatgaaagtgagcaggaacaggaagaagaggaa
caggaggaaaatgaagatcaagacgaaccagaacaagaaccacctgggattcccgaagag
tttatttttgacccagaaggggtaattctcgaccccagtgtgttgtattttgctcagatg
tcccaacgtcaagggaaatcaggtagccgcagtatcattttgtcagaggatcgggggcgc
tacatcaagccgatgttacccaagggcaaagtcaaacgcatcgctgtggatgccacccta
cgggctgctgcaccttatcaaaaatcacggaaagaacgacagccaaatcgcaaagtagtg
gtggaaccgggggatatgcgggcaaaacggttggttcgcaaagctggcgcgttaattata
tttctggtggatgcatctggttccatggcattaaatcggatgcaatcagcgaaaggtgcg
gtgatgcaattactaactgaagcatatcaaaaccgtgaccaagtatctttaattcccttt
cgtggtgaacaagcagaggttttgttacctcccacccgttccattgccatggcaaagaac
cgcttggaaaggttgccctgtggaggtggttcacctttagcgcatggattaacccaggct
gtgcgggtgggagtaaacgcccaaatgagtggcgatatcgggcaggtggtaattgtggca
attactgatggacgtggtaacattccgctatcacgttccctcggtgaaccccaagatcct
gataataaacccgatattaaagctgagttattggatattgctgccagaattagggctatg
ggaatgcagcttttggtaattgacaccgaaagtaagttcgtttccacaggttttgctaag
gaattagccaaaacatcgggaggtaaatattaccatttacctaaagcaaccgaacaggca
atagcggcaatgacgcgaggtgcgatcgctgatatcaaatcacgctga

DBGET integrated database retrieval system