KEGG   Calothrix sp. PCC 6303: Cal6303_1751Help
Entry
Cal6303_1751      CDS       T02372                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00860  Porphyrin and chlorophyll metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cal6303_1751
Enzymes [BR:calt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cal6303_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 MCM Sigma54_activat CCDC53 VWA_3 AAA_2 Trypan_PARP PRCC Mito_fiss_reg PAXIP1_C Mg_chelatase_C
Motif
Other DBs
NCBI-ProteinID: AFZ00789
UniProt: K9UZ96
Position
2093189..2095216
Genome map
AA seq 675 aa AA seqDB search
MPASTAPSITAFPLAAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALL
PPIEVMKGSISNCDPNHPEDWDDLLLEDTPNVEGNTEIIPAPFIQIPLGVTEDRLLGSVD
VEKSVKEGDTVFQPGLLAAANRGVLYVDEINLLDDQISNQLLSVLSEGRNQIEREGISFQ
HPCKALFIATYNPEEGGLREHLLDRIAITLSADGVMGVDQRVEAVEQAISYSRSPQDFLE
QYDEDIDALKTQIILAREWLKEVKISHEQIAYLVDEALRGQVQGHRAELFAVRVAKAAAA
LEGRNQVTPEDLKRAVELVIVPRATVIQTPPEESPPPPPPPPQNQEEPEDESEQEQEEEE
QEENEDQDEPEQEPPGIPEEFIFDPEGVILDPSVLYFAQMSQRQGKSGSRSIILSEDRGR
YIKPMLPKGKVKRIAVDATLRAAAPYQKSRKERQPNRKVVVEPGDMRAKRLVRKAGALII
FLVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVSLIPFRGEQAEVLLPPTRSIAMAKN
RLERLPCGGGSPLAHGLTQAVRVGVNAQMSGDIGQVVIVAITDGRGNIPLSRSLGEPQDP
DNKPDIKAELLDIAARIRAMGMQLLVIDTESKFVSTGFAKELAKTSGGKYYHLPKATEQA
IAAMTRGAIADIKSR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgtccactgctccaagtattacagctttccctttggctgccgtagtcggtcag
gaagcgattaaaatagccttattactcgcagccgtagatccgggtttgggaggagttgcg
atcgcaggtcgtcgcggtacggcaaaatctgtgatggcacgcgctattcatgcccttcta
ccccccatcgaagtgatgaagggttccattagtaattgtgaccctaatcacccagaagat
tgggatgatttgcttttagaagatacccccaatgtagaaggaaatacagaaattattccc
gcaccttttattcagattcctctaggtgtcaccgaggatcggttattaggttcggttgat
gtggaaaaatcagtcaaagaaggtgacacagtattccaacctgggttactggctgcggca
aatcgaggtgtgttgtatgtggatgaaatcaacctcctggatgaccaaattagcaaccag
ttattaagcgtactctccgaaggacgcaaccaaattgaacgggaaggaatcagcttccaa
cacccctgcaaagccttatttattgccacctacaaccccgaagaagggggattacgggaa
cacctacttgacagaatcgccattactctctccgcagatggtgtcatgggtgtagatcag
cgcgttgaagctgtggaacaagcaatttcctactcccgttccccccaagactttttggaa
cagtacgacgaagatattgacgcactcaaaactcaaattattttggcgcgagaatggctc
aaagaagtcaaaatcagccacgaacaaatagcatatttagttgatgaagcattgcgggga
caggtgcagggacaccgcgccgagctttttgcagtgcgtgtcgccaaagctgcggcggct
ttggaaggacggaaccaagttacccccgaagatttgaagcgtgccgtggaattagtaatt
gtaccgagggcaacggtaattcagacacctccagaggaatcaccaccaccccctccccca
ccaccacagaatcaggaagaacctgaagatgaaagtgagcaggaacaggaagaagaggaa
caggaggaaaatgaagatcaagacgaaccagaacaagaaccacctgggattcccgaagag
tttatttttgacccagaaggggtaattctcgaccccagtgtgttgtattttgctcagatg
tcccaacgtcaagggaaatcaggtagccgcagtatcattttgtcagaggatcgggggcgc
tacatcaagccgatgttacccaagggcaaagtcaaacgcatcgctgtggatgccacccta
cgggctgctgcaccttatcaaaaatcacggaaagaacgacagccaaatcgcaaagtagtg
gtggaaccgggggatatgcgggcaaaacggttggttcgcaaagctggcgcgttaattata
tttctggtggatgcatctggttccatggcattaaatcggatgcaatcagcgaaaggtgcg
gtgatgcaattactaactgaagcatatcaaaaccgtgaccaagtatctttaattcccttt
cgtggtgaacaagcagaggttttgttacctcccacccgttccattgccatggcaaagaac
cgcttggaaaggttgccctgtggaggtggttcacctttagcgcatggattaacccaggct
gtgcgggtgggagtaaacgcccaaatgagtggcgatatcgggcaggtggtaattgtggca
attactgatggacgtggtaacattccgctatcacgttccctcggtgaaccccaagatcct
gataataaacccgatattaaagctgagttattggatattgctgccagaattagggctatg
ggaatgcagcttttggtaattgacaccgaaagtaagttcgtttccacaggttttgctaag
gaattagccaaaacatcgggaggtaaatattaccatttacctaaagcaaccgaacaggca
atagcggcaatgacgcgaggtgcgatcgctgatatcaaatcacgctga

DBGET integrated database retrieval system