KEGG   Calothrix sp. PCC 6303: Cal6303_1872Help
Entry
Cal6303_1872      CDS       T02372                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cal6303_1872
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cal6303_1872
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cal6303_1872
Enzymes [BR:calt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cal6303_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2225481..2226785
Genome map
AA seq 434 aa AA seqDB search
MTQAIAKQAHVNTGNFKALKCKECGAEYEPKALHVCELCFGPLEVKYDYSNLRLSVTRES
IQAGPNSIWRYRDFLPVATDNYIDVGTGMTPLVKSNRLARRLGLKNLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAYAGLDCCVFIPSDLEAGKVLGS
LVYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWKL
PDHVVAPLASGSLFTKIYKGFQEFVEVGLVEDKKVRFSGAQAEGCSPIAEAFKEGRDFIK
PVKPNTIAKSLAIGNPADGVYAVELAQKTGGNIESVTDAEIIEAIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAVQGYIGEPFTIDAKLDSFESALER
SRTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcgatagcaaaacaggctcacgtaaatactggtaacttcaaagcgttgaag
tgtaaggagtgtggtgctgaatatgaacccaaagcactacatgtgtgtgagctttgcttt
ggtcctttggaagtaaagtatgactatagtaatttgcgcctttctgtaacccgcgaaagt
attcaagctggtcccaactcaatttggcgctatcgtgattttctcccagttgctaccgac
aactatatagatgtgggtacggggatgactccattagttaaatctaatcgcttggcacgt
cgtttaggtctaaaaaatctctacatcaaaaacgatgctgtaaacatgcctaccctcagc
tttaaggatcgggtggtatctgtggctttgagtcgagcgcgggaactaggctttacaact
gtatcctgtgcaagtacaggaaacctagctaattctacagctgcgatcgctgcctacgcc
ggattggattgttgtgtattcatcccttctgatttagaagctggtaaagtcttaggtagt
cttgtttatagtccaactttgatggctgtaaaaggtaattacgaccaagttaaccgcctg
tgttcagaagtagctaacacacatggttggggatttgtcaatattaatcttcgcccctat
tattctgaaggttccaaaacattaggctttgaagttgccgaacaactgggatggaaactc
ccagaccacgttgttgcacctttggcttctggctcgttgtttactaagatctacaaaggc
ttccaagaatttgtcgaagttggtttagtcgaagataaaaaagtccgtttcagtggtgct
caagcagaaggttgttcacccatcgctgaagctttcaaagaaggaagagacttcataaaa
ccagttaaacccaacacaatcgctaaatccctcgctattggcaaccccgcagatggtgta
tacgcggtggaactggcacagaagacaggtggtaatattgaatcagtaactgatgccgaa
atcatcgaagccatcaagttactggctgaaaccgaaggcatatttacggaaaccgcaggt
ggaaccaccgttgctgtattgaagaagttggtggaagctggaaaaatcgatccagatgaa
actaccgtggtttacattactggtaatggtttgaaaacccaagaagctgttcaaggttac
attggtgaacccttcacaattgatgcaaaactcgatagctttgaaagtgcgcttgagcga
tcgcgtactttggatcgcttagaatggcagcaagtcttggtttaa

DBGET integrated database retrieval system