KEGG   Calothrix sp. PCC 6303: Cal6303_1905Help
Entry
Cal6303_1905      CDS       T02372                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cal6303_1905
Enzymes [BR:calt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cal6303_1905
Peptidases [BR:calt01002]
 Cysteine Peptidases
  Family C44
   Cal6303_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266616..2268643)
Genome map
AA seq 675 aa AA seqDB search
MSGIIGIYYPNGQIVDPENIQQMVDKLAHRGPDGADIWCSESVGLGHRMLWTTPESLLEK
LPMVSEDGNLVITSDCRIDNREELLSRLQLNNCPPEKVTDTDLILAAYQEWGEDCPQHLL
GDFAFAIWDAREQKLFCVRDHMGVKPFYYYASDNVFVFGSEIKAILCLPEVPRKLNETKV
GDYLASLLQDKVNTFYQGIFRLPPASYLTVSGKGLKIGCYWKLDPNYELQLNSDEEYADK
LREIFTEAVRCRLRSAFPIGSHLSGGLDSSSVTCVARQLLVGEKKPLLHTFSNIFNAVPE
CDERPFIEAVLEQGDIIPHYVDGDRIGPLSDIEQIFQYNDEAVSGPTHFLAWELNEATKQ
EGVRIILDGFDGDNTISHGHGYFSELMLREEWSTLREEITALHQLSGASFRNILRYYGLP
YLEDLVRRWRWIRAIALIHQVSLIFQISRRSLFFQYGIKPLLPESILKAWRKLRGHSQPK
RDDSSIVNRRFAQLIGLKKRIQSSITLSGSQLLKTRESHWQGLNAGILTQGLEILDRYAA
AFSLEARHPFMDKRLIEFCLSLPPEQKLQQGWSRYVMRRAMENILPQPVQWRYGKSSMSA
SFVHGLLEHDRQLLEEVMENKLNSMAEYIDVKVLHEDYRELLASNKTQILEGGLDVSIWQ
VAMLTLWLRHSLKIV
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaattatcggaatttactatcccaatggtcaaattgttgaccctgaaaatatt
cagcagatggttgataaacttgcccatcgcggacctgatggtgcagatatttggtgttcg
gagtctgtaggtttgggacaccggatgctgtggactacaccagagtcactactggagaaa
ctacctatggtcagtgaggatgggaatttggttattacatctgattgtcgcatagataat
cgtgaggaactgctgtcaagattgcagttgaataactgtccaccagagaaggttactgat
actgatttgattttggctgcatatcaggaatggggtgaagattgcccacagcatctactt
ggggactttgcttttgcgatttgggatgcaagggaacagaagctattttgtgtccgcgat
cacatgggtgtgaaaccattttattactatgcatcagataacgtttttgtttttggtagc
gagattaaagcaattttgtgtttgccggaagttccccgaaaactcaacgaaaccaaagtt
ggtgattatttagcttcgttactgcaagataaagtcaacactttttatcagggtattttt
cggcttccacctgctagttatttaactgtcagtggtaaaggcttgaaaattggttgttac
tggaaactcgatcccaactatgaactacaactaaattctgatgaggaatatgctgataag
ttacgagaaatatttaccgaagcagtacgctgtcgtctccgtagtgctttcccaataggt
tctcatctgagtggtggtttagattcttcttcagttacttgcgtagcacgacagttactt
gtaggagagaagaaacctttattgcatacattctcgaatattttcaatgctgttcctgaa
tgtgacgagcgcccttttattgaagctgttcttgaacagggagatataattcctcactat
gtggatggtgatcgtataggtcctctatcagatattgagcaaatatttcaatacaatgat
gaagctgtttctggtcctacgcattttttggcatgggaactgaatgaagctacaaaacag
gaaggagttcggattatactggatggctttgatggtgataatacaatatcccacggtcat
ggctatttcagtgaattaatgcttcgggaagaatggtcaactcttagagaagaaattact
gcgttgcatcaacttagtggtgcttcgttcagaaatattctgcgatattatggtctacca
tacttggaagacttagtgagacgctggcgatggattagggcgattgcgctcatccatcaa
gtttccctgatctttcagatttcaaggcgatcgcttttctttcagtacggcatcaaacct
ctgctacctgagtccatactcaaggcttggcgaaaattacgcggacatagtcaaccaaaa
agggatgacagttcgattgttaaccgtcgcttcgcccaacttataggtctcaaaaagcgt
attcagagttctatcactctatctggaagtcaactactcaaaacaagggaaagtcactgg
caaggtctaaacgcaggtatattaacccaaggattagaaattctggatcgatatgcagca
gcattctcccttgaagctcgtcacccatttatggataaacgactgattgagttctgttta
tctcttcctccagagcagaaattgcagcagggatggtctcgctatgtcatgcggcgtgcc
atggaaaatattcttccccagccagtgcagtggcgttacggaaaatccagtatgagtgct
agttttgtgcatggattactagagcacgatcgccaacttctagaggaagtgatggaaaat
aagttaaatagcatggctgaatatattgatgtcaaagttctccatgaggattatagagaa
ttgctagcttctaacaaaactcagatcctcgaaggtgggttagatgtatctatttggcag
gtagctatgctaactctttggctgcgtcattctctgaaaatagtgtga

DBGET integrated database retrieval system