KEGG   Calothrix sp. PCC 6303: Cal6303_1939Help
Entry
Cal6303_1939      CDS       T02372                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:calt01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:calt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2307674..2308576)
Genome map
AA seq 300 aa AA seqDB search
MQIRRRQPSPIIAVSMIRYQAALPDAKPNNILEEIVWQKETEVEQMREKVPLQKLQKQAL
EAPPTRDFLAALRQGRTTPALIAEVKKASPSKGVIREDFDPSAIALQYERGGASCLSVLT
DEKFFQGSFDNLAKIRDTVELPLLCKEFIIHPYQMCLARVRGADAVLLIAAILTDQDLQY
FLRIAKKLSMTVLIEVHTLEELDRVLTLDGVSLIGINNRNLEDFTVDLQTTSQILAARGE
ELQKRNILVVSESGLYTPEDLDIVAQAGASAVLIGESLVKQPDPELAVKNLFAKSRSEIK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgtcgtcgtcaacctagtcccatcattgctgtatcaatgatccgttaccaa
gcagcattgccggatgcaaagccaaacaatatcctagaggagattgtttggcaaaaagaa
accgaagttgagcaaatgcgggaaaaagttccattacagaaattgcaaaagcaagcactg
gaggcacctcccactcgtgattttttggcagctttgcgtcaagggagaaccacacctgcc
ttaattgcggaagttaagaaagcatctcccagtaaaggtgtaattcgtgaggatttcgat
cctagcgcgatcgcgttacagtacgaacggggtggtgctagctgcttatctgtattaaca
gatgagaaattttttcaaggtagctttgataacctcgccaagatacgtgatactgtagag
ctaccacttttatgtaaagaatttattatacatccgtatcaaatgtgtttagcgcgggtt
cgcggcgctgacgctgttttattgattgcggcaattctcactgatcaagatttgcagtac
ttcctaagaatcgccaaaaaacttagcatgaccgtactgattgaagttcatactctagaa
gaactagatcgggtactgactttagatggtgtttctttaataggtataaataatcgcaat
ttggaagattttaccgttgatctacaaacaacatcccaaatactagcagcaagaggtgag
gaattacagaagcgtaatatcttagttgtgagtgaatcaggattatatacccctgaagat
ttggatatagttgcccaagctggagcatctgctgtattaataggggaatcactagtaaaa
caacctgatccggaattagctgtcaaaaacctctttgctaaatctcgatctgaaattaag
taa

DBGET integrated database retrieval system