KEGG   Calothrix sp. PCC 6303: Cal6303_2143Help
Entry
Cal6303_2143      CDS       T02372                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Cal6303_2143
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cal6303_2143
Enzymes [BR:calt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Cal6303_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2554655..2555200
Genome map
AA seq 181 aa AA seqDB search
MKITPTKIPDVLLIEPKIFSDERGFFYESYNQKTLFNQVNITQHFVQDNHSRSVKNVLRG
LHYQINQPQGKLIKAILGEIFDVAVDLRTSSQYFGQWVGVNLSAENKQQLWIPPGFAHGF
LVLSDYAEILYKTTDFYAPEHERTIIWNDPEIGINWSLTESPILSAKDQAGKYLKSAEVY
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataacaccaaccaaaattcctgacgtattgctaattgaaccaaaaatttttagt
gacgaacgtggttttttctacgaaagctataatcaaaaaaccttattcaatcaagtaaat
attactcagcactttgtccaggataatcactcgcggtctgtaaaaaacgttctccgtggt
ctacactaccaaataaatcaaccccagggaaaactcatcaaagcaatcctcggtgaaata
ttcgatgttgcagttgatttacgtactagttctcaatactttggtcaatgggttggtgtt
aacttaagcgcagaaaacaaacagcaactatggattccacccggatttgcccatggcttt
ttggtactttcagattatgcggaaatactatataaaaccacagatttttatgcaccagaa
catgaacgtaccattatttggaatgatccagaaattggcattaactggtctttaacagaa
tcacccatactttcagccaaagatcaagcaggtaaatatctcaaatcagccgaggtatac
ccatga

DBGET integrated database retrieval system