KEGG   Calothrix sp. PCC 6303: Cal6303_2974Help
Entry
Cal6303_2974      CDS       T02372                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:calt00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:calt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3498787..3500274)
Genome map
AA seq 495 aa AA seqDB search
MKLRELLAAVDGIVALPEHPAMDMEIEGLTTNSHATNVGELFVGMPGTRVDGGEFWQSAL
AAGAVAAIISTAAAAKVPPTADVCVITTSDMTKACAKISAAFYGYPGHALKLIGVTGTNG
KTTTTHLIEFLLDKASLKTALMGTLYTRWQGFSQTAVHTTPFAVELQQQLAAAVDAGNEY
GVMEISSHALAQGRVLGCKFEVGVFSNLTQDHLDYHKDMEDYFNAKALLFSPNYLQGRAI
INIDDSYGQRLIQALGDEKVWSYSVNNTQANLWMSDLNYQQNGISGTLHTPKGNVKFHSP
LVGQYNLENLLAAVGAVLHFDVDLDLVADAISEFPGVPGRMERVQLSENQDISVIVDYAH
TPDSLENLLKASRPFIPGKIICVFGCGGDRDKTKRPKMGKIAAELADVAVVTSDNPRTED
AEQILKDILVGIPENTNPIVICDRAQAIRTAILSAKPGDGILLAGKGHEDYQILGTEKIH
FDDREHAKDALKARV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgagaattgcttgcggctgttgatggtattgtggcattacccgaacatcca
gccatggatatggaaattgaaggcttaacaacaaactcccatgccaccaatgtgggagag
ttatttgtgggtatgcctggtacaagggttgatggcggagaattttggcaaagtgcttta
gcagcaggtgctgttgcggcgattatttccacagcagcagcagcaaaagttccccccact
gctgatgtttgtgtcatcaccacttcggatatgacaaaagcctgtgcaaaaatatcggct
gcattttacggatatccaggacatgcgctgaaattaatcggggttacgggtactaatggc
aaaaccacaactacccacttgattgaatttttgttggataaggcaagcctcaaaactgct
ttaatgggtaccctgtatacccgttggcaagggtttagtcagactgctgtccatactacc
ccctttgcagtggagttacagcaacaacttgcagcagcagtggatgcgggaaatgagtat
ggggtgatggaaattagttcccatgctttggcacagggaagggttttaggttgtaaattt
gaagttggggtatttagtaatctcacccaagatcatttggactaccacaaagatatggaa
gattactttaatgccaaagctttactatttagtcctaactatcttcaaggtagagcaatt
attaatatagatgattcctatggtcagcggttaattcaggctttaggagatgaaaaggtt
tggagttatagcgttaataatactcaagctaatctgtggatgagtgatttaaattaccaa
caaaatggaataagtgggactttacatactcctaaaggtaatgttaaatttcattcacct
ttagttggtcaatataatctggaaaatttgttagcggcagtaggtgcagttttacacttt
gatgtggatttggatttagttgctgatgctatttctgaatttcctggtgttcctgggaga
atggaaagggtacaacttagtgaaaatcaagacattagtgtgattgtagactatgcccat
acccctgatagtttggaaaacctgttaaaagcatcacgcccatttattcccggtaagatc
atttgtgtatttggttgtggtggtgatagagataaaaccaagcgtccaaaaatgggtaaa
attgccgcagaattagctgacgttgctgtggtgacatctgataaccctcgcaccgaagac
gcagaacagatactcaaggatattttagtgggaatccccgaaaatactaatcctattgtg
atatgcgatcgcgctcaagcaattcgtaccgctattttgtcagctaaacccggagatggt
atcctacttgcaggtaaaggtcacgaagattaccaaattcttggtactgagaaaatccac
ttcgatgatcgagaacatgcaaaagatgctttaaaagccagagtttga

DBGET integrated database retrieval system