KEGG   Calothrix sp. PCC 6303: Cal6303_2984Help
Entry
Cal6303_2984      CDS       T02372                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:calt00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:calt00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:calt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3512510..3513850
Genome map
AA seq 446 aa AA seqDB search
MLQLFPKKVIGLMVLSVALTLMFTPQLLAKTSGSGNVIFIHPDGTSAAHWGAARMLYKGP
DARLNWDRMSNLAVYLGHIKNQLTATSNAGAVTHATGVKVNADSFGLDEAGKPVVALSGK
PQTIMEEAIAAGKATAIINSGMIHEPGTGAFVAKSPSRRNFADITKQIVESGADVILGGG
ELWYLPKDKAGRHTTAQQSQRTDGINVIELAKKKGYTVVYTRDELLKLPTNTKKVLGIFA
ADDTYNDDTEENLKKQGLPLYVKSAPTVAQQLQVTLRLFSQRRNGFLIVLEEEGSDNFSN
YNHAAGCMEAVKRADDAVGVAMDFIQKNPNTLLVTAADSDAGGLEVVGVTEKDFPLNKPV
PEKSKNGSPWDGRDGTGTLPFVSAPDKQGKRFPFAVGWSTFGDNTGAIVAKAHGLNAQLL
HGTVDNTDIYRLMYRTLFGKQLANKG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttacagctatttccgaaaaaagttattggtttaatggttctgagtgtcgccttaact
ttaatgtttacaccacagttattagctaagacttctggctcaggtaatgtgatatttatt
catcctgatggtactagtgcagctcattggggggcggcgcggatgctctacaagggaccg
gatgctaggctcaattgggataggatgtctaatttagccgtctacctgggacatattaaa
aaccaactcacggcgacttctaacgctggtgcagtgactcacgctacaggggtgaaggta
aatgctgattcctttgggttggatgaagcgggtaaaccagtagtggcgctgtcgggtaaa
ccccagacaattatggaagaagcgatcgccgcaggtaaagcaactgctatcatcaattcg
gggatgattcacgaaccgggtacgggtgcgtttgtggctaagtcacctagtcgccgcaac
tttgcagacattactaaacaaatcgtcgagtctggtgcagatgtaatcttaggcggtggt
gaactttggtatctccccaaggataaagccgggagacacaccacagcacaacaaagtcaa
cgcacggatgggattaatgtcatcgagttggcaaaaaagaagggttacaccgttgtttac
acccgcgatgagttgctaaagttacccacaaataccaaaaaagtgttaggaatttttgcc
gcagatgatacttacaacgacgacacagaagaaaatttaaaaaaacagggtttaccgttg
tatgtcaagagtgcgccgacagtcgcccaacagttacaggtgactttacgcctgttctct
cagaggcgtaatggcttcttgattgttttggaagaagagggtagcgataatttttctaac
tataatcatgcagccggttgtatggaagcagtgaaacgcgctgatgatgcggttggggta
gcaatggattttattcaaaagaaccccaatactttgttagtcaccgccgccgatagtgat
gctggcggtttggaagtggtgggagtaacagagaaagactttcccttgaataaaccagtc
ccagaaaaaagcaaaaatggttcaccttgggatggtagagatggaactggtactttaccg
tttgtttctgcaccagacaaacaaggtaaacgttttccctttgcagtcggttggtctact
ttcggcgataatacaggagcgatcgttgctaaggcgcatggtttaaatgctcaactctta
catggcacagtcgataacaccgatatttatcgcctgatgtaccgtaccctctttggtaag
cagttggcgaataagggctag

DBGET integrated database retrieval system