KEGG   Calothrix sp. PCC 6303: Cal6303_2984Help
Entry
Cal6303_2984      CDS       T02372                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cal6303_2984
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cal6303_2984
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cal6303_2984
Enzymes [BR:calt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cal6303_2984
Exosome [BR:calt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cal6303_2984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3512510..3513850
Genome map
AA seq 446 aa AA seqDB search
MLQLFPKKVIGLMVLSVALTLMFTPQLLAKTSGSGNVIFIHPDGTSAAHWGAARMLYKGP
DARLNWDRMSNLAVYLGHIKNQLTATSNAGAVTHATGVKVNADSFGLDEAGKPVVALSGK
PQTIMEEAIAAGKATAIINSGMIHEPGTGAFVAKSPSRRNFADITKQIVESGADVILGGG
ELWYLPKDKAGRHTTAQQSQRTDGINVIELAKKKGYTVVYTRDELLKLPTNTKKVLGIFA
ADDTYNDDTEENLKKQGLPLYVKSAPTVAQQLQVTLRLFSQRRNGFLIVLEEEGSDNFSN
YNHAAGCMEAVKRADDAVGVAMDFIQKNPNTLLVTAADSDAGGLEVVGVTEKDFPLNKPV
PEKSKNGSPWDGRDGTGTLPFVSAPDKQGKRFPFAVGWSTFGDNTGAIVAKAHGLNAQLL
HGTVDNTDIYRLMYRTLFGKQLANKG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttacagctatttccgaaaaaagttattggtttaatggttctgagtgtcgccttaact
ttaatgtttacaccacagttattagctaagacttctggctcaggtaatgtgatatttatt
catcctgatggtactagtgcagctcattggggggcggcgcggatgctctacaagggaccg
gatgctaggctcaattgggataggatgtctaatttagccgtctacctgggacatattaaa
aaccaactcacggcgacttctaacgctggtgcagtgactcacgctacaggggtgaaggta
aatgctgattcctttgggttggatgaagcgggtaaaccagtagtggcgctgtcgggtaaa
ccccagacaattatggaagaagcgatcgccgcaggtaaagcaactgctatcatcaattcg
gggatgattcacgaaccgggtacgggtgcgtttgtggctaagtcacctagtcgccgcaac
tttgcagacattactaaacaaatcgtcgagtctggtgcagatgtaatcttaggcggtggt
gaactttggtatctccccaaggataaagccgggagacacaccacagcacaacaaagtcaa
cgcacggatgggattaatgtcatcgagttggcaaaaaagaagggttacaccgttgtttac
acccgcgatgagttgctaaagttacccacaaataccaaaaaagtgttaggaatttttgcc
gcagatgatacttacaacgacgacacagaagaaaatttaaaaaaacagggtttaccgttg
tatgtcaagagtgcgccgacagtcgcccaacagttacaggtgactttacgcctgttctct
cagaggcgtaatggcttcttgattgttttggaagaagagggtagcgataatttttctaac
tataatcatgcagccggttgtatggaagcagtgaaacgcgctgatgatgcggttggggta
gcaatggattttattcaaaagaaccccaatactttgttagtcaccgccgccgatagtgat
gctggcggtttggaagtggtgggagtaacagagaaagactttcccttgaataaaccagtc
ccagaaaaaagcaaaaatggttcaccttgggatggtagagatggaactggtactttaccg
tttgtttctgcaccagacaaacaaggtaaacgttttccctttgcagtcggttggtctact
ttcggcgataatacaggagcgatcgttgctaaggcgcatggtttaaatgctcaactctta
catggcacagtcgataacaccgatatttatcgcctgatgtaccgtaccctctttggtaag
cagttggcgaataagggctag

DBGET integrated database retrieval system