KEGG   Calothrix sp. PCC 6303: Cal6303_3022Help
Entry
Cal6303_3022      CDS       T02372                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal6303_3022
Enzymes [BR:calt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cal6303_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3565398..3567008
Genome map
AA seq 536 aa AA seqDB search
MRHIWKRKRQKSKLYQKFVILSVAIAVFFGGILPKLPIESQSTAAVPPVAMQLPLSTRGA
KIVDAKGKTVLLRGLNWFGMETESHAPHGLWKRDYQEMLSQMKILGYNVIRFPYSVEALR
STEVRSIDYNIGRNAELQGKTPLEVMDLVIQAAEKQGLLILLDSHRLSDKRIPPLWYGDG
FTEADWIDTWKMLAQRYKNQANVIGADLKNEPHGKASWGTSNLATDWRLAAERAGNAILG
INPNWLIVVEGVADNVPGQKLKHHWQGGNLEGVRRYPVRLSRRNKLVYSPHEYGPGVYKM
PYFQEKGFPGNMRSRWETGFYYIARKQIAPILIGEFGGRNVDTKSTEGIWQNQLVKFIAE
KNLSYTYWSWNPNSGDTGGVLLDDWQTVDVPKQVLLSKILPVKFNPPSIAVVNKGTTPSQ
PPKPSQPIPQNYSFSPLQVTTEIDSDWESGYCMSLKISNPSNSKIQNWQLRFSMNQAEIN
QSWNANFQQQAKSKYIVTPLDWGKVIEPTQVRDIGFCAKKLGNDYQPQKIEIIKGN
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatatctggaagcggaaacggcaaaaatcaaaactttatcaaaaattcgttata
ctttctgttgcgatagcagtcttttttggggggatattgccaaaattaccgatcgaaagc
caatctaccgctgctgttcctcctgttgcaatgcaactaccactatcaacccgtggagca
aaaattgttgacgctaaaggtaaaacagtattattacgggggttaaattggtttgggatg
gaaactgaatcccatgcaccccacggtttatggaagcgggattaccaagagatgctttcg
caaatgaaaatcttgggatataacgtgattcgctttccttactccgtagaggcattacgc
tcaacagaggttcgcagtattgattataacattggtcgtaatgctgaacttcaaggtaaa
acacccttggaagtgatggatttagtgattcaagcagccgaaaaacaaggattgttaatt
cttctcgacagtcatagactcagcgataaaagaattcctcccctatggtacggagacggg
tttacagaagcagactggattgatacctggaaaatgctggcacagcgctataaaaaccaa
gctaacgtaatcggtgcagatttgaaaaacgaaccccacggtaaagctagttggggtaca
tccaatcttgccacagattggcgactcgccgcagaacgggcaggtaatgcaattttgggt
ataaatcccaactggttaatcgtagttgaaggtgttgcagataacgttcctgggcaaaaa
cttaagcatcattggcaaggcggaaacttagagggtgttagacgctacccagtacgttta
tcacgtcgcaataaactagtatattcaccccatgaatatggtccgggggtatataagatg
ccctacttccaagaaaagggctttcctggtaatatgcgatcgcgttgggaaactggcttc
tattatattgcccgtaaacaaatcgcacctattttaatcggggaatttggtggtagaaat
gttgacacaaaatccacggaaggaatttggcaaaatcaactagttaaatttatcgctgag
aaaaacctcagttatacttactggagttggaatcctaacagtggtgacactggtggagtt
ttgctagatgattggcaaactgtagatgttcccaaacaagttttactgtcgaaaatccta
ccagtcaagtttaatcctccatctatagcagtagttaataagggtactactccatctcaa
ccaccaaaacctagccaaccaattccacaaaactattcgttttctcccctacaagtcaca
accgaaatagattcagattgggaatcaggatattgcatgagtctcaaaattagcaacccc
agcaacagtaaaatccaaaattggcaacttagattcagcatgaatcaagctgaaattaac
caatcctggaatgccaactttcagcaacaagcaaaaagtaagtatattgtcactccctta
gattggggaaaagtcatcgaacccactcaagttagagatataggcttttgtgccaagaaa
ttgggtaacgattatcaaccgcaaaaaattgaaattatcaaagggaattaa

DBGET integrated database retrieval system