KEGG   Calothrix sp. PCC 6303: Cal6303_3031Help
Entry
Cal6303_3031      CDS       T02372                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Other glycan degradation
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:calt00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3583291..3585705)
Genome map
AA seq 804 aa AA seqDB search
MRTQSSSTIPPVTWNRPIGLGWEKPYTVRYASNIDDGPWHGMPLGGFGAGCIGRSHGGDF
NFWHIDGGEHVFKNIPACQFSLFESVGESSQAYALATAAPADGTLQSWKYYPQSSPEQNT
GTYHALYPRSWFEYGGVYQANITCQQFSPIWADNYQESSYPVAVFLWNLHNPTNAPITLS
IMLTWENMVGWFTNTSKSPEVIVRDDGSPVYEYQPRLGQSQGNFNEIVDNGNTIGVVLSG
ISGEVVQEGDGQWCFLTSKQAGVEIFSHSRWNPTGNGEEIWQSFAADGSLSNYQDATPAT
DERLAGALAVRLTLQPGETLEVPFVLTWDFPVTEFAAGVNYNRRYTDFFGSNGKNALQIA
ETALEQYRDWLEKIQTWQKPILNRHDLPDWMKMALFNELYDLTAGGTLWSAASPKDPVGQ
FAVLECLDYRWYESLDVRLYGSFGLLMLFPELEKAVMRAFARAIPASDEKTRVIGYYYTI
GAESPLAIRKAAGATPHDLGAPNEHVWEKTNYTSYQDCNLWKDLGSDFVLQVYRDFVFTG
SKDIEFLAECWDAIALTLEYLKAFDKDHDGIPENSGAPDQTFDDWKLQGVSAYCGGLWLA
ALEAAIAICDILLENHGDQEKLTAQKIIYTDWLAKSRPIYQQKLWNGQYYRLDSESGSDV
VMADQLCGQFYARLLKLADIVPHDCAISAVRTVYEACFINFNDGKFGAANGLRPDGSPEN
PKATHPLEVWTGINFGLAAFLMQMGMQDEAWKLTEVVVQQIYDNGLQFRTPEAITATGTF
RACTYLRAMAIWGIYLVLIGNSEQ
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcagtcttcctcaacaattcctcctgtaacttggaatcgtcccatcggttta
ggttgggaaaagccttatactgtgcgctatgccagtaatattgatgatggtccctggcat
ggaatgcctctaggtggatttggcgctggttgcattgggcgatcgcatggtggagatttt
aatttctggcatattgatggtggggaacatgtgttcaaaaatattcccgcttgtcaattt
agtctgtttgagtcggttggtgagtcatcccaagcttatgctttagctacagcagcaccc
gcagatggaacattgcaaagctggaaatattacccccaaagttctccagaacaaaatacg
ggaacttaccatgctttatatccccgtagttggtttgaatatgggggagtatatcaagca
aatattacctgtcagcagttttcaccaatttgggctgataattaccaagaatctagttat
ccagtggctgtatttttgtggaatttacataatcccaccaatgcacccattactctgagt
attatgcttacctgggaaaatatggtgggttggtttactaatacttccaaatctccagaa
gtgatagtacgggatgatggtagccctgtgtatgaatatcagccacgtttgggtcaaagt
caaggtaattttaacgaaatagttgacaatggtaacaccataggggttgttttaagcggt
attagtggtgaagtagttcaagaaggcgatgggcaatggtgttttctcaccagtaagcag
gcaggagtcgaaatattttcccattctcgctggaatcccactggtaacggggaggaaatt
tggcaaagtttcgccgcagatggttctttaagtaattaccaagatgccacacctgcaaca
gatgaacgattggcgggtgctttagctgtgcgcttgactttgcaacctggagaaacccta
gaagttccttttgttttgacttgggatttcccggtgacagaatttgctgcgggagtaaat
tacaatcgtagatacactgatttttttggtagtaatggcaaaaatgcattacaaattgcc
gaaacagctttagaacaataccgagattggttagaaaaaattcagacatggcaaaaaccg
atactcaatcgccatgatttaccagattggatgaagatggctttgttcaacgaactttac
gatttaactgctgggggtactttgtggagtgcagcatcacccaaagatcctgtggggcag
tttgcagttttagaatgtttggattatcggtggtatgaaagcttagatgtgcggttgtat
ggttcctttgggttgttgatgctgtttcctgagttggaaaaagccgtgatgcgggcattt
gcccgggcaattccggcgagtgatgagaaaacccgcgtcattggttactactacacaatt
ggtgccgaaagtcccctagctatccgtaaagctgctggggcaacaccccatgatttagga
gcgccaaatgaacatgtgtgggaaaaaaccaattataccagttaccaagattgcaatttg
tggaaagacttgggtagtgactttgtgttgcaagtataccgagattttgtatttacaggt
agcaaagatatagaattcctggctgaatgctgggacgcgatcgcattaactctagaatac
cttaaagcctttgacaaagatcatgatggtatccccgaaaattccggcgcacccgatcaa
acctttgatgattggaagttacagggagttagcgcttattgtggtgggttatggttagca
gctttggaagcagctattgccatctgtgatatcttgctggaaaaccatggagatcaggaa
aaacttaccgcccaaaagataatttatacagactggctggcaaaatctcgcccaatttat
caacaaaaactttggaatggacaatactatcgtctcgatagtgaaagcggttcggatgta
gtgatggcagatcagttatgtggtcaattttacgcccgtttgctgaaattagctgatatt
gtcccccacgattgtgccatctctgccgtgcgaacagtttacgaagcttgttttatcaac
tttaacgacggcaaatttggcgctgcaaatggtttgcgtcccgatggttcaccagaaaac
cccaaagcaactcatccgttagaagtgtggacaggtattaattttggcttggctgccttt
ttgatgcaaatgggaatgcaggatgaagcttggaaattaacggaagttgtagtgcaacaa
atttacgacaatggcttacagttccgtactccagaagcaattactgcaactggaactttc
cgtgcttgtacttatttgcgagctatggcaatttggggaatatatttagtgttaataggg
aacagtgaacagtaa

DBGET integrated database retrieval system