KEGG   Calothrix sp. PCC 6303: Cal6303_3350Help
Entry
Cal6303_3350      CDS       T02372                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cal6303_3350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cal6303_3350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cal6303_3350
Enzymes [BR:calt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cal6303_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3970778..3971869)
Genome map
AA seq 363 aa AA seqDB search
MTVSLSPATSYRQPWAGLIETYRPYLPVSESTPVVTLLEGNTPLIPAPSLARYIGRGVKV
LVKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRGGMKAFVLI
PDGYVALGKLAQALLYGAEVLAIQGNFDRALEIVREMSEQYPVTLVNSVNPYRIEGQKTA
AFEIVDTLGDAPDWLCIPVGNAGNITAYWMGFCEYHQMGKCDRLPKMMGFQAAGAAPLVY
GQPVAHPETIATAIRIGNPASWDKAVAAKSASMGEFNAVTDEEILNAYRILASEEGVFCE
PASAASVAGMLKVKDQIPTGATVVCVLTGNGLKDPDTAIKHSGNQFKQGIAPDVLDVAKA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtaagcctgtctcctgctacatcctaccgccaaccttgggctgggttaatcgaa
acctaccgtccttacctaccagtgagcgaaagtaccccagttgtgacattactggaaggt
aatacacccctgattcccgccccatccctggcgagatacattggtagaggtgtgaaggta
cttgtgaaatatgatggtttaaatcccacaggtagctttaaagaccgagggatgaccatg
gcaatcactaaggcaaaagaagccggagccaaggcagtgatttgtgctagtacaggaaat
acctcagcagccgcagccgcatacgcacgacggggtggaatgaaagcctttgttttgata
ccagatggttatgttgccctcggtaaattagcgcaagctctgctttacggggctgaagtc
ttggcaattcaaggcaactttgatcgcgctttagaaatagttcgggaaatgtcagaacaa
tatcccgtgacattggtgaattctgtcaacccttaccgcatcgaaggacagaaaaccgca
gcttttgaaatagttgataccctgggtgatgctcctgattggttgtgtatcccggttgga
aatgccggaaacatcacagcttattggatggggttttgtgaataccaccaaatgggaaag
tgcgatcgcttacccaaaatgatgggctttcaggcagcaggtgcagcaccattggtatat
gggcaaccagtagcacaccccgaaaccatcgctacagcaatccgtatcggcaaccccgca
agctgggataaggcagtggcagccaaatctgcaagtatgggagaatttaatgccgttact
gacgaggaaattctcaacgcctacagaattttagcatcagaagaaggtgtcttctgtgaa
cctgccagcgccgcatccgtagctggaatgttgaaagtcaaagatcaaattcccacaggt
gcaacagttgtttgtgtccttaccggaaatggactcaaagatccagatacggcaattaaa
cacagtggcaaccaatttaaacagggtattgccccagatgttctagatgttgcaaaagcg
atgggattttag

DBGET integrated database retrieval system