KEGG   Calothrix sp. PCC 6303: Cal6303_3350Help
Entry
Cal6303_3350      CDS       T02372                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00260  Glycine, serine and threonine metabolism
calt00750  Vitamin B6 metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
calt01120  Microbial metabolism in diverse environments
calt01230  Biosynthesis of amino acids
Module
calt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cal6303_3350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cal6303_3350
Enzymes [BR:calt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cal6303_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 TPR_14 PK_C TPP_enzyme_N TPR_4 PA
Motif
Other DBs
NCBI-ProteinID: AFZ02289
UniProt: K9V3K0
Position
complement(3970778..3971869)
Genome map
AA seq 363 aa AA seqDB search
MTVSLSPATSYRQPWAGLIETYRPYLPVSESTPVVTLLEGNTPLIPAPSLARYIGRGVKV
LVKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRGGMKAFVLI
PDGYVALGKLAQALLYGAEVLAIQGNFDRALEIVREMSEQYPVTLVNSVNPYRIEGQKTA
AFEIVDTLGDAPDWLCIPVGNAGNITAYWMGFCEYHQMGKCDRLPKMMGFQAAGAAPLVY
GQPVAHPETIATAIRIGNPASWDKAVAAKSASMGEFNAVTDEEILNAYRILASEEGVFCE
PASAASVAGMLKVKDQIPTGATVVCVLTGNGLKDPDTAIKHSGNQFKQGIAPDVLDVAKA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtaagcctgtctcctgctacatcctaccgccaaccttgggctgggttaatcgaa
acctaccgtccttacctaccagtgagcgaaagtaccccagttgtgacattactggaaggt
aatacacccctgattcccgccccatccctggcgagatacattggtagaggtgtgaaggta
cttgtgaaatatgatggtttaaatcccacaggtagctttaaagaccgagggatgaccatg
gcaatcactaaggcaaaagaagccggagccaaggcagtgatttgtgctagtacaggaaat
acctcagcagccgcagccgcatacgcacgacggggtggaatgaaagcctttgttttgata
ccagatggttatgttgccctcggtaaattagcgcaagctctgctttacggggctgaagtc
ttggcaattcaaggcaactttgatcgcgctttagaaatagttcgggaaatgtcagaacaa
tatcccgtgacattggtgaattctgtcaacccttaccgcatcgaaggacagaaaaccgca
gcttttgaaatagttgataccctgggtgatgctcctgattggttgtgtatcccggttgga
aatgccggaaacatcacagcttattggatggggttttgtgaataccaccaaatgggaaag
tgcgatcgcttacccaaaatgatgggctttcaggcagcaggtgcagcaccattggtatat
gggcaaccagtagcacaccccgaaaccatcgctacagcaatccgtatcggcaaccccgca
agctgggataaggcagtggcagccaaatctgcaagtatgggagaatttaatgccgttact
gacgaggaaattctcaacgcctacagaattttagcatcagaagaaggtgtcttctgtgaa
cctgccagcgccgcatccgtagctggaatgttgaaagtcaaagatcaaattcccacaggt
gcaacagttgtttgtgtccttaccggaaatggactcaaagatccagatacggcaattaaa
cacagtggcaaccaatttaaacagggtattgccccagatgttctagatgttgcaaaagcg
atgggattttag

DBGET integrated database retrieval system