KEGG   Calothrix sp. PCC 6303: Cal6303_3526Help
Entry
Cal6303_3526      CDS       T02372                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:calt01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:calt01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4184712..4185563
Genome map
AA seq 283 aa AA seqDB search
MTVKSNSHATTGGDSGAIAQPLNWTYIIFFAAFHLLALLAPWFFSWQALFTALFLHWLCG
SIGICLGYHRLLSHKSFQVPQWLEYAIAICGALALQGGPIFWVGGHRIHHAHTEDVDKDP
YSAKRGFWWSHILWLFYPRPEFFNREIYQKSAPDLARQPFYQWLDRHFLLLQVPLALLLY
ALGGWSFVIYGIFVKSVLLWHSTWFVNSATHTWGYKTFAADDNARNLWWVSVVTYGEGWH
NNHHTYPNVAKSGYKWWEIDPTWWSIRALQRLGLAKKVILYKS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacagttaaatcaaattcccacgccactacgggcggagattctggtgcgatcgcgcag
ccactcaattggacatacatcatattttttgccgcatttcatctgttagcgttacttgca
ccatggtttttttcctggcaagccttatttacagcgctgtttttgcattggctatgtggt
agtattggcatctgcttaggatatcaccgattattaagccataaaagttttcaagtaccc
caatggttggaatatgcgatcgctatttgcggcgctctagcactacaaggtggtccaata
ttttgggttggtggacaccggatacatcatgcccatacagaggatgtcgataaagatccc
tattctgccaagcgcggattttggtggagtcacatactgtggcttttctacccacgtcca
gagtttttcaaccgcgaaatataccaaaaatctgccccagatttagcacgacaaccattt
tatcaatggcttgaccgtcatttcctcttgttgcaagttcctttagctctattactatac
gctttgggtggatggtcttttgtgatctacggaatctttgtcaaatcagtattgctatgg
cactcaacctggtttgttaattccgcaacacacacatggggatataaaacttttgccgca
gatgataatgcccgtaatctttggtgggtttccgttgtcacctatggagaaggatggcac
aataatcaccatacctatcccaatgtcgccaaatctgggtataaatggtgggaaatagat
cctacttggtggagtattcgagcattgcagagattgggtttagcgaaaaaagtcatctta
tataaatcgtaa

DBGET integrated database retrieval system