KEGG   Calothrix sp. PCC 6303: Cal6303_3654Help
Entry
Cal6303_3654      CDS       T02372                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cal6303_3654
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal6303_3654
   00052 Galactose metabolism
    Cal6303_3654
   00500 Starch and sucrose metabolism
    Cal6303_3654
   00520 Amino sugar and nucleotide sugar metabolism
    Cal6303_3654
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cal6303_3654
   00524 Butirosin and neomycin biosynthesis
    Cal6303_3654
Enzymes [BR:calt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cal6303_3654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4348613..4349500)
Genome map
AA seq 295 aa AA seqDB search
MNKEVIGIDLGGTAIKLGRFTDDGKCLQSLIVKTPQPAMPETVLVEIVNAIGQLDPSHNC
VSIGVGMPGPADPDGRIALVSINLPGWRDVPLAAWLEEKTGKPTILANDANCAGLGEAWL
GAGRRFQNFIMLTLGTGVGGAIFINGKLFIGHHGAAGELGLITLHADGPVCNSGNQGSLE
QFTSIRAIRRLTGKEPSELAALAEMGDIQALEFWAEYGRNLGIGLSSLVYVLTPEAILLG
GGISASSKFFLPTVTTEIEKRVFITSRIGLEILPAELGNAAGMLGAAKLALTKIS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaagttattggcattgatttagggggaacagcgattaagttgggcagattt
acagacgatggtaaatgcctacaatcattaatagttaagactccccagcctgcaatgcca
gagacagtgttagtagagattgtgaatgcgatcggacaattagatccaagccacaattgc
gttagtattggtgtgggaatgccgggacctgctgatcctgatggacgtatcgccctagtt
tcaattaatctcccaggctggcgtgatgtgccgttggcggcttggttggaggaaaaaacc
ggaaaacctacgattcttgctaatgatgccaactgtgcgggtttgggtgaggcttggcta
ggtgctggcagacgatttcaaaattttattatgctgactttaggtactggagttggtggg
gcaatctttattaatggtaaattatttattggtcatcatggtgcagccggggaattaggt
ttaattaccctccatgctgatggtcctgtatgtaatagtggaaaccaaggttctttagaa
caatttacatcaatccgggcaattcgtcgcctcacaggcaaagaaccctcagaactcgct
gctttggcagaaatgggagatattcaagctttggagttttgggcagaatacggacgtaat
ttaggtattggattatctagcttggtgtatgtactcaccccagaggcgattttattgggt
ggtggaattagtgctagttccaagttttttttacctacagtcacaaccgaaattgaaaag
cgggtttttatcacttctcgcatcggtttagaaatattaccagcagaattgggcaacgca
gccggaatgttaggtgctgcaaagttagctttgacgaaaattagttag

DBGET integrated database retrieval system