KEGG   Calothrix sp. PCC 6303: Cal6303_3912Help
Entry
Cal6303_3912      CDS       T02372                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cal6303_3912
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal6303_3912
   00520 Amino sugar and nucleotide sugar metabolism
    Cal6303_3912
Enzymes [BR:calt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cal6303_3912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4661172..4661876
Genome map
AA seq 234 aa AA seqDB search
MEEHYQVRTLSIDIGGSGIKVMILDSQGNPLGERLRLETPQPATPEAVINTIAKLIAEAG
EFERVSVGFPGVVRRGVVETAANLNPSWIGFNLAAELSKILRKPVRVINDADMQGLGAIT
GKGVELVITLGTGFGSALFLDGKLVPNLEMGHHRFRKNQTYEEQLGRDALNRVGSKKWNR
RIEKAIASLNKLFNYDYLYIGGGEATKVKIQLPANTKIIPNISGLIGGIALWRD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacattatcaagtgcgaacactatcaattgatattggtggtagtgggataaaa
gtgatgattctcgatagtcaaggaaatcctttaggtgagagactgcgcttagaaacccct
caacctgcaacaccggaagctgtaattaataccattgccaaattaattgcggaggcagga
gaatttgaacgggtatcggtgggttttcctggggtggtgcgtcgtggagttgtagaaact
gcggcaaatctcaatcctagctggattggttttaatttagctgctgagttaagtaagatt
ttgcggaagcctgtacgggtaattaatgatgctgatatgcagggtttaggtgcgattact
ggtaagggtgtggagttggtgattaccttgggcactggatttggttcggctttatttttg
gatgggaagctggtaccaaatttggaaatgggacatcatcggtttcgcaaaaaccaaact
tacgaagaacagttaggacgtgacgctctaaatcgggtaggatctaagaaatggaaccgt
cggattgagaaagcgatcgcgtctttaaataaactatttaattacgactacctttacatt
ggtggtggtgaagctacaaaggtaaaaattcaacttccagcaaatacaaaaattatcccc
aatattagcggtttaattggtgggattgctctctggcgagattag

DBGET integrated database retrieval system