KEGG   Calothrix sp. PCC 6303: Cal6303_3912Help
Entry
Cal6303_3912      CDS       T02372                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:calt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:calt00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:calt00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4661172..4661876
Genome map
AA seq 234 aa AA seqDB search
MEEHYQVRTLSIDIGGSGIKVMILDSQGNPLGERLRLETPQPATPEAVINTIAKLIAEAG
EFERVSVGFPGVVRRGVVETAANLNPSWIGFNLAAELSKILRKPVRVINDADMQGLGAIT
GKGVELVITLGTGFGSALFLDGKLVPNLEMGHHRFRKNQTYEEQLGRDALNRVGSKKWNR
RIEKAIASLNKLFNYDYLYIGGGEATKVKIQLPANTKIIPNISGLIGGIALWRD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacattatcaagtgcgaacactatcaattgatattggtggtagtgggataaaa
gtgatgattctcgatagtcaaggaaatcctttaggtgagagactgcgcttagaaacccct
caacctgcaacaccggaagctgtaattaataccattgccaaattaattgcggaggcagga
gaatttgaacgggtatcggtgggttttcctggggtggtgcgtcgtggagttgtagaaact
gcggcaaatctcaatcctagctggattggttttaatttagctgctgagttaagtaagatt
ttgcggaagcctgtacgggtaattaatgatgctgatatgcagggtttaggtgcgattact
ggtaagggtgtggagttggtgattaccttgggcactggatttggttcggctttatttttg
gatgggaagctggtaccaaatttggaaatgggacatcatcggtttcgcaaaaaccaaact
tacgaagaacagttaggacgtgacgctctaaatcgggtaggatctaagaaatggaaccgt
cggattgagaaagcgatcgcgtctttaaataaactatttaattacgactacctttacatt
ggtggtggtgaagctacaaaggtaaaaattcaacttccagcaaatacaaaaattatcccc
aatattagcggtttaattggtgggattgctctctggcgagattag

DBGET integrated database retrieval system