KEGG   Calothrix sp. PCC 6303: Cal6303_3918Help
Entry
Cal6303_3918      CDS       T02372                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cal6303_3918
Enzymes [BR:calt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cal6303_3918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4672462..4676091
Genome map
AA seq 1209 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAQLGVSRCQELDIHIFTDRDISSKPGEVEKALVGADVFF
GSLLFDYDQVMWLRDRISQIPIRLVFESALELMSCTKIGAFAIGDKPKGMPKPVKFILDK
FSNGKEEDKLAGYISFLKIGPKLLKFLPFGKVQDLRNWLIVYGYWNAGGTENVAALFWVL
AEKYLNLPVGDIPPVIETPNIGLLHPEYQGYFESPQAYLKWYQHRDNSPCPHQKPIIGIL
LYRKHVITKQPYIPQLIRNFEDAGLIPLPIFINGVEGHVAVRDLMTTEYETQQRLQGNNA
TLSLSKQAVKVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKNILSAKNVPYFVAAPLLIQD
IHSWTRQGIGGLQSVVLYSLPELDGAIDTVPLGGLVGEDIYLVPERVQRLIGRVKSWINL
HRKAPSERKIAIILYGFPPGYGATGTAALLNVPKSLIKFLTALKTQGYDIPNLPEDGEEL
IRLVKEKDEGEFTTVNVRTLEKWLGYLQTKRIEQQWQSLNKSGIKTFGDELQVGGLELGN
IWIGVQPPLGINGDPMRLMFERDMTPHPQYAAYYKWLQNEFQADAVVHFGMHGTVEWLPG
SPLGNTGYSWSDILLGNLPNLYIYAANNPSESILAKRRGYGVLISHNVPPYGRAGLYKEL
LTVRDLISEYREDPEKNYLLKEGICKKILDTGLDADYPFTEGKKLGIALTPENIKMFSNH
AFNDYLVSLYEYLQFLENRLFSSGLHVLGEAPNEESMQSYLDAYFSEGYHEEEANKIRQL
LSQNTDEITNLLRGLNGEYIPPAPGGDLLRDGAGVLPTGRNIHALDPYRMPSPAAYERGR
EIAQKILQQNLEINGKYPETVAVMLWGLDAIKTKGESLGILLELVGAEPVKEGTGRIVRY
ELKPLAEVGHPRIDVLANLSGIFRDSFVNIIELLDDLFERAANADESETENFIKKHALAL
KSQGVENASARLFSNPAGDFGSLVNDQVVDGNWENGDELGNTWQSRNGFSYGRKDKGQAR
PEILQTLLKTTTQIVQEIDSVEYGLTDIQEYYANTGGLKKAAEKQGEKKVKTSFVESFSK
DTTPRDLDDLLRMEYRTKLLNPKWAEAMVNQGSGGAYEVSQRMTALIGWGGTADFTDDWV
YEQAADTYAFDSEMADKLRQANPEAFRNIIGRMLEANGRGFWDADAEKLEKLRQLYDVTD
EALEGVAAK
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgttttaatcgctggttttgaatcatttaatgctgacttgtaccgaaaa
gctgcacagttaggggtttctcgttgtcaagaattagatatccacatctttactgacagg
gatattagtagcaaaccgggggaagtagaaaaagctttagttggtgcggatgtatttttt
ggcagtttgttatttgattatgaccaggtaatgtggttacgcgatcgcatttcccaaata
cccatacgtttggtgtttgaatcagccttagaattgatgagttgtaccaaaattggtgct
tttgccattggcgacaaacccaagggaatgcccaaacctgttaagtttattttagataag
tttagtaatggcaaggaagaggataagcttgcaggctatattagtttcctgaaaatagga
cctaaattactcaaattcttaccgtttggcaaagtacaggatctccgcaactggctaatt
gtctacggttattggaatgcagggggaacagagaatgttgcagctttgttttgggtgctt
gccgagaaatatctaaatttacctgttggggatattcccccagttatagaaacccccaat
ataggtttactccaccctgaatatcaaggttattttgaatccccccaagcttacttaaaa
tggtatcaacacagggataattctccatgtcctcaccaaaaaccgataattgggattctc
ctctaccgcaaacatgttattaccaagcaaccttatattccccaactaattcgcaacttc
gaggatgcaggtttaattcccctccccatttttatcaacggagtggagggacatgttgca
gtgcgggatttgatgacgactgagtatgaaacacaacaaagacttcagggaaataatgcc
actctttccctttccaagcaagcagtaaaagttgatgcaattgtctccaccattggtttt
ccgctagttgggggaccagcaggttctatggaagctggtagacaagtagaagtagcaaaa
aatattctctcagctaagaatgttccgtactttgtcgctgcacccctgctaattcaagat
attcactcctggacaaggcaaggtattgggggtttacaaagcgtcgtattatactcatta
cccgaacttgatggggcaattgatactgtacctttgggtggtttggtaggtgaagatatt
tatttggtaccagagagggtacagcggttaattggtagggtgaaaagttggatcaatttg
caccgaaaagctcccagtgagcggaaaattgccattattctctatggttttccaccggga
tatggggcaaccggaaccgcagctttattaaatgttcccaagagtttaattaagttttta
acagctttgaaaactcaaggttatgacatccctaatttgccggaagatggggaagaattg
attcgcttggtgaaggaaaaggatgagggagaatttactacagttaatgtgagaaccttg
gaaaaatggctaggttatctccaaactaagcggattgagcagcaatggcaatctctaaat
aaaagcggcataaagacttttggagacgagttacaagtaggtggattggagttgggaaat
atttggattggagttcaaccacctttaggaatcaacggtgatccgatgcggttgatgttt
gaacgggatatgacaccccatcctcaatatgcggcttattataaatggttacaaaatgaa
ttccaagctgatgcggttgtgcattttggaatgcatggaacagtggaatggttgcccggt
tctccgttaggaaatacaggttattcttggtctgatatcttattgggtaatctgccaaat
ttatatatctatgccgcaaacaacccttcagaatcaatcttagctaaacgtcgaggttat
ggggtattaatttcgcataatgttcctccctatggacgtgcgggtttatataaggagttg
ttaactgtaagagatttaattagtgagtatcgagaagatccggaaaaaaattacctactt
aaagaaggtatttgtaagaaaattctcgacacaggtttagatgccgactacccctttacc
gaaggtaagaaactaggcattgctttaacacctgagaatatcaagatgtttagtaatcat
gcatttaatgattacttagtaagtttatacgaatatctacaatttttagaaaatcgttta
ttctcatctggtttacatgtcttgggtgaagcaccaaacgaagaatcaatgcagtcatat
ttagatgcatattttagtgaaggatatcacgaggaagaagcaaataaaattcgacaatta
ctatcccaaaacactgatgaaatcaccaacttacttcgaggtttaaatggcgaatatatt
cccccagcccctggaggtgacttactccgagatggggcaggtgtattaccaactggaaga
aatattcatgctttagacccttaccgaatgccttctcctgctgcatatgaaaggggtagg
gagatagctcaaaaaatccttcagcagaacctggaaattaacggcaaatatccggaaact
gtagcagttatgttgtggggtttagatgcaatcaaaactaaaggtgaatccttggggatt
cttttagaattggttggcgcagaacctgtaaaggaaggaacaggaagaatagttagatat
gaattaaaacctttagcagaagttggacatcccagaattgatgttttagctaatttatca
gggatttttcgtgatagttttgtgaatattattgaactattagatgacttatttgaacgt
gcagcaaatgcagatgaatcagagacagagaactttattaaaaaacatgctttggcttta
aaatctcaaggtgtggagaatgcttccgccagattgttttctaaccccgcaggtgatttt
ggatctttagttaatgatcaagttgtggatgggaactgggaaaatggtgatgaattggga
aatacctggcaaagtcgtaacggttttagttatggcagaaaagataaaggacaagcacgt
ccagaaattttacaaacattactaaaaaccacaactcaaatagttcaagaaattgactct
gtggaatatggattaactgatattcaagaatactacgcgaatacggggggattaaagaaa
gcagcagaaaaacaaggtgaaaaaaaggtaaaaactagctttgtggaaagtttttccaag
gatacaacacctcgtgatttagatgatttactccggatggaataccgtaccaaattacta
aatcctaaatgggcggaagcaatggtaaatcaaggttccggcggtgcctatgaggtctct
cagcgcatgacagcattaattggttgggggggtactgccgattttacagatgactgggtt
tacgaacaagctgctgatacctatgcttttgatagcgagatggcagataaattacgtcaa
gcaaatcctgaagcttttcgcaatattattggcagaatgttagaagcaaatgggaggggt
ttttgggacgcagatgcagagaaattggagaaattacggcagttatatgatgtaacggat
gaggctttggagggggttgcagcaaaataa

DBGET integrated database retrieval system