KEGG   Calothrix sp. PCC 6303: Cal6303_4332Help
Entry
Cal6303_4332      CDS       T02372                                 

Definition
MCP methyltransferase, CheR-type with PAS/PAC sensor (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:calt02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:calt02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5203833..5205677)
Genome map
AA seq 614 aa AA seqDB search
MGNEEDKVFETLLDYLKWTRGFDFSGYKRSTLQRRIRKQMQSREIESFGDYLDYLEVHPE
EFIELLNTILINVTGFFRDASAWDYLRNQLIPQIISNKAANEPIRVWSAGCASGEEAYTL
AMILAEALGASEFRQRVKIYATDVDEDALTHARSASYTKQAIKSVPVELQEKYFEPMGNR
QVFRVDLRRVVIFGRHDLMQDAPISRLDLLVCRNTLMYFNADAQARMLSRFHFALNPTGF
LFLGKAEMLLTHSNLFTPLSLQHRIFAKVPKVHIRDRLLGLGQTGDEEASNLVAMHMQLR
EAALNSMPIAQLVIDCTGNLAIANLAARLMFGITLQNIGSPLRDLEISYRPVELRSRIEQ
IYSDRHTIIISDVVRNLPDGSIQYLDVQLTPLQENGENLLGVGIAFKDVTNYHNLQTELQ
RVTQELETANEELQSSNEELETTNEELQSTNEELETTNEELQSTNEELETMNEELHSTNE
ELQTINDELRERTQELNQINAFLQSILASIQAGVVVIDPQFNILSWNQETENLWGLRTEE
VKGQSFFNLDIGLPVGELREAIRTCLAGKNHIQLDIDATNRRGRSFRCRVTCNPLIGTTG
ERQGVILVMEEAES
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgaagaagataaggtatttgaaacactgttagattacttaaaatggacaaga
ggttttgatttttcaggttataaacgctctactttacagcgacgcatccgtaaacaaatg
cagtcgcgggaaattgaatcttttggggattatttggattatttggaagttcacccagaa
gagtttattgagcttttaaatacaattttaattaatgtcactggtttttttcgtgatgct
tccgcttgggattatcttcgcaatcagttaataccccaaattatcagtaacaaagcagca
aatgaaccaattcgggtgtggagtgctggttgtgcttcgggagaagaagcttatacccta
gcaatgattttggcagaagctttgggagctagtgagtttcgtcaacgagttaaaatatat
gcgactgatgtggatgaagatgctttaacccatgctcgttctgctagttataccaagcaa
gcgattaaatctgttcctgtagagttgcaagaaaaatattttgaaccgatgggaaatcgg
caagtatttcgggtagatttgcgtcgagtggtaatttttggtcgtcatgacttaatgcaa
gatgctcccatttcccgcttagatttgttggtatgtcgtaacaccttaatgtacttcaat
gccgatgctcaagcaagaatgttgtcacggtttcattttgccctcaatcctacaggtttt
ttatttttggggaaagcagagatgttgcttacccacagtaatttatttacacctttgagt
ttacaacatcgcatctttgccaaagtacctaaggtacatatacgcgatcgcttacttggt
ttagggcaaactggtgatgaggaagctagtaatcttgttgctatgcatatgcagttgcgg
gaagctgccctaaattccatgcccattgcccaattagtgatagattgtactgggaactta
gcgatcgctaatttagcagcaaggttaatgtttggtatcactctccaaaatattggcagt
cccctgcgagatttagaaatttcctaccgtcccgtcgaattgcgatcacgtattgaacaa
atatatagtgatcgtcataccataattatttctgatgtggttcgcaacctccccgatggc
agtatccaatatttggatgtgcaactcacacccctacaggaaaatggcgaaaatttgctc
ggagtgggaattgcctttaaagatgtcaccaactaccacaacctgcaaacggaattgcaa
cgggtaactcaagaactggaaactgctaacgaagaattgcaatctagtaacgaagaacta
gaaacaactaacgaggaattgcaatccaccaacgaagaactagaaaccaccaacgaggaa
ttacaatctaccaacgaagaactagaaacaatgaacgaagaactccactccaccaacgaa
gaattacaaacaattaatgatgagttgcgagagcgtacccaggaactcaaccaaatcaat
gctttcctccaatccatcctcgccagcattcaagctggggtagttgtaattgacccccaa
tttaacatcctcagttggaatcaagaaactgaaaacctttggggattaagaaccgaagaa
gtcaaaggacaatcattttttaatttggatattggtttacctgtgggggaactacgggag
gcaatccgaacttgtcttgctgggaagaatcacatacagttggacatagatgccaccaat
cgtcggggtcgaagttttcgctgtcgagtcacctgcaatcccctaattggcaccacagga
gagcggcagggggttatcctcgttatggaggaagcagaatcatga

DBGET integrated database retrieval system