KEGG   Calothrix sp. PCC 6303: Cal6303_4333Help
Entry
Cal6303_4333      CDS       T02372                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:calt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cal6303_4333
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cal6303_4333
Enzymes [BR:calt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cal6303_4333
Two-component system [BR:calt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cal6303_4333
Bacterial motility proteins [BR:calt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cal6303_4333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5205667..5206305)
Genome map
AA seq 212 aa AA seqDB search
MEKSFSESEQINPKHPGDSKFRIVAIACSAGGLQAVSKVISALPANFPVPIVIVQHLDPK
HRSMMADILSRRTKLQVKQAEQGELMNPGTIYIAPPNYHLLVTSQGSVELTQSEVIHFVR
PSADVLFESVANSYESQAIAVILTGTGVDGAVGVREIKEKGGIVIVEDSETSEFDGMPKA
AIKTGIVDQVLPLSEIARALITLVMGHKADGE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcattttcagaatcagagcaaattaaccctaagcatcctggtgatagtaag
ttcaggattgtagcgatcgcatgttctgcgggagggttacaagcagtgagtaaagtcatc
tctgctttacctgccaattttcctgtaccgattgtgatcgtacagcatcttgacccgaaa
caccgctcaatgatggcggatattttgagtagacgcactaagttgcaggtgaaacaagca
gagcagggagaattgatgaatcctggaacaatttatattgctccaccaaattaccattta
ttggtgactagtcagggttctgtggaactgacacaatcggaggtgatacattttgtgcgt
ccatctgctgatgtgctgtttgagtcagttgcaaatagttatgaatcgcaggctattgct
gtaattttaacaggaacaggtgtggatggggcagttggggtgagggaaattaaggagaag
ggtggaattgtgattgtggaggatagtgaaacatctgaatttgatggaatgcctaaagca
gcgattaaaacaggtatagtagatcaagttttaccattatccgaaattgcgagagcttta
attaccttggtaatgggacataaagctgatggggaatga

DBGET integrated database retrieval system