KEGG   Calothrix sp. PCC 6303: Cal6303_4456Help
Entry
Cal6303_4456      CDS       T02372                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
calt  Calothrix sp. PCC 6303
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Cal6303_4456
Enzymes [BR:calt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Cal6303_4456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5356108..5359491)
Genome map
AA seq 1127 aa AA seqDB search
MTRLSNSIENLKNHYKIVVIGSGYGGGIAASRLARAGQNVCILERGKEFQPGEYPNTELK
AIEQLQIDLPNKHIGSKTGLYDFHVNKDINVFVGCGLGGTSLINANVSLRAERRVLEDTR
FPQKLRDDINTLLAEGYERAEEMLKPTPYPEFGFPPLPKLAALEKSAEFLNEKFYRPPIN
VTFQDGVNHVGVEQKKCNLCGDCVTGCNNKAKNTTLMNYLPDAKNHGAEIYTQISVQWVE
RQGDKWLIHYQLLGSGREKFQAPTMFISADIVILAAGTLGSTEILLRSAAHGLPVSSQLG
GNFSGNGDVLAFGYNTDQKINAVGYGNLPAEKMEAVGPCITGIIDIREQPRLENGMVIEE
GSIPGAISRLLPKVFASAGEILGKDTDSGIKDFAKEKFREFESKVYGARTGAVNNTQTYL
VMTHDNAGGRMYLESDRLRVEWQAVGEQPIFERVNSRLTDATKPLGGTQIPNPVWSQVFK
QKDLVTVHPLGGCIMGENATSGVVNHKGQVFADVQGEEVHTGLYVCDGAVIPRSLGVNPL
LTISAIAERCCRLIAQDYGWEINYNLPEMPMAIDNPEGETVGIEFTETMRGNFSLENTNI
ETKFEFTLSIIASDLEKMLADVTHPAKIIGTVTAPAISPTPLTVTNGEFNLFVVDVDGIN
TKKMHYRFPMWDEDGKIYYLDGFKIIHDHPGFDLWDDTTTLYITVHDGDTTDAAILGKGV
LKIQPQDLMRQMSTVRITNTQNRQQRIEYTAKFGKLFLGVLFNTYGEIFARPSVFKPGAL
PRQKRTLRVSTPEVYFFQTPGESSVQLRLTRYQGGKKGPVMLVHGLGVSSSMFSIDTIDT
NLVEYLYANEYDVWLLDYRSSIELAASQTTYTGDDIALKDYPVAVDKIRQITSSETIQVI
VHCFGATTFFMAMLAGLKGVRSAVCSQMATHLKVPLMTALKSGFYLASTLEMLGISSLTA
YVDSNANWLNQLYDKALKLYPVDAGDGDNSPVSRRISFIYGQLYELDQLNQATYNAMHEM
FGIVTMRSLEHIALMIRKGHLVNILGQEDYIPHLERLAIPITFIHGEKNNCLLPKSTEIS
HRLLAQKNGKHLYTRHVIPNYGHLDCILGKNASYDVYPLILEHLEKT
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtttatcaaactcaattgaaaacttaaaaaatcactataaaatagttgttatc
ggctccggatatggtggaggaatcgccgcctcaagacttgctagagccggacaaaatgtg
tgtattttagaacgggggaaggagtttcaaccaggtgaatacccaaatacagaattaaaa
gccattgagcaactacagattgatttacccaataaacatatcggttcaaaaactggtttg
tatgattttcatgttaacaaagatattaatgtctttgttggttgtggtttgggaggaact
tctttaatcaatgccaatgtatccttacgtgcagaacgtcgagttttagaagatacccgt
ttcccgcaaaagctaagagacgatattaatacactgttggctgaaggatatgaacgggct
gaggaaatgttaaaacccacaccttacccagagtttggttttcctccacttcccaagtta
gcagctttggaaaagtcggcagaattcctgaacgaaaagttctatcgtccccccattaat
gtgactttccaagatggagtgaatcatgtaggggtggaacagaaaaaatgtaatctttgc
ggcgattgtgtcacaggttgtaataataaagccaaaaatacaacgttgatgaattatcta
ccagatgcaaagaatcacggtgcagaaatttatactcagatttcagttcaatgggtagaa
agacaaggtgataaatggttgattcactaccaattacttggttccggaagagaaaagttc
caagcacccacaatgtttatcagtgcagatattgtgattttagctgcgggaactttaggt
tctactgaaatcttactacgttcggcagcgcatgggttgcctgtttcgagtcaactgggt
ggtaattttagcggcaatggggatgtgttggcatttgggtacaacacagatcagaaaatt
aatgctgttggttacgggaatttgccagcagaaaaaatggaagctgttggaccctgcatt
acaggtattattgacatacgggaacaaccacgtctggaaaatgggatggtaattgaagag
ggttccattcccggtgcgatttctcgactgcttcccaaagtatttgcaagtgctggggaa
attctggggaaagacacagatagtgggattaaggattttgccaaggaaaaattccgagaa
tttgaaagtaaagtgtatggtgcgcgtacaggtgctgtcaataatactcaaacctacctg
gtgatgacccacgacaacgcaggtggtaggatgtacctagaaagcgatcgcttgcgggtt
gaatggcaagctgtaggggaacaacccatttttgaacgggtcaatagtcgcttaactgat
gccacaaaacccctgggtgggactcaaattcccaatccagtttggagtcaggtatttaag
caaaaagatttagtcacagtacatcccctcggtggttgcatcatgggagaaaatgccaca
tctggagtagttaaccacaaaggacaggtatttgcagatgttcaaggtgaagaagttcac
actgggttatatgtctgcgatggtgcagttattccccgttcattaggggtaaatccatta
ttgaccattagtgcgatcgctgaacgctgttgtcggttaattgctcaagattatggatgg
gaaattaactacaatttacctgaaatgcccatggcaatagataatcctgaaggggaaact
gtgggaattgagtttacagaaaccatgcgtggtaatttctctctagaaaacacaaacatt
gaaacaaagtttgaatttacccttagtatcattgcatctgatttagaaaaaatgctagct
gatgtaactcatccagccaaaattattggaactgtcacagcaccagctatctcacccaca
cccctaaccgtaaccaatggggaatttaatctgtttgtggtggatgtagatgggataaat
actaaaaagatgcattatcgtttccccatgtgggatgaagatggcaaaatctattatctt
gatggtttcaaaatcattcacgatcatcctggttttgatctctgggatgacaccacaact
ttatatatcacagtccacgatggtgatactactgatgctgccattctcggtaaaggtgta
cttaaaattcaacctcaagacttaatgcggcaaatgtccacagtccgcatcaccaatacc
cagaaccgacaacagcgtatagaatataccgccaagtttggtaaattgtttcttggagta
ctatttaatacctatggtgaaatctttgctcgtcccagtgttttcaagccaggtgcatta
cctcggcaaaaacgcacattacgagttagcacaccagaagtatatttttttcaaactcct
ggagaatcatccgtacaactgagattaaccagatatcaaggtgggaaaaaaggtccagta
atgttggttcacggtttaggggtatctagcagcatgttcagcatcgatacaattgatact
aatttagttgagtatctctatgccaatgaatatgacgtttggctactagattaccgttcc
agcatcgaattagctgcatctcaaaccacctacacaggtgatgatatcgcattaaaagat
tacccagtagcagtcgataaaatcagacaaattacaagcagcgagactattcaagtcata
gttcactgctttggtgctaccacattcttcatggcaatgttagcaggattaaaaggggtt
cgtagtgcagtttgttcgcaaatggctacccatctaaaagtgcctttgatgactgcgtta
aaatcaggattttatcttgcctcaactttagaaatgttagggatatcatctttaacagca
tatgttgatagtaatgctaattggctaaatcaactttatgacaaagctttaaagttgtat
ccggtggatgctggtgatggggataacagtcccgtaagtcggcgaatttcctttatatat
gggcagttatatgaattagaccagttaaatcaggcaacatacaacgccatgcatgaaatg
tttggcatcgtaactatgcgaagtttagaacacatcgctttaatgattcgcaaaggtcat
ttagttaacattttggggcaagaagactacattcctcatttagaacggttagcaattccc
ataacttttatccacggagaaaaaaataactgtttactcccaaaaagcaccgaaatcagc
catagattattagcacaaaaaaacggtaaacatctatatacacgtcatgtaatacccaat
tatggacacctagattgtattttaggtaaaaatgcttcttatgatgtttatccgttgata
ttggaacatttggaaaaaacataa

DBGET integrated database retrieval system