KEGG   Calothrix sp. PCC 6303: Cal6303_4534Help
Entry
Cal6303_4534      CDS       T02372                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00020  Citrate cycle (TCA cycle)
calt00640  Propanoate metabolism
calt00660  C5-Branched dibasic acid metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
calt01120  Microbial metabolism in diverse environments
calt01130  Biosynthesis of antibiotics
calt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cal6303_4534
   00640 Propanoate metabolism
    Cal6303_4534
   00660 C5-Branched dibasic acid metabolism
    Cal6303_4534
Enzymes [BR:calt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cal6303_4534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: AFZ03434
UniProt: K9V6U5
Position
complement(5453240..5454481)
Genome map
AA seq 413 aa AA seqDB search
MDLLEYQVKEWFGDIGIPVLPSQRIDHPTDLKRLKIPFPIVLKSQVYGGGRLKSGGVRFA
DTTIDAIASAQNIFNLSIVGELPEVVLAETKYNAEMEIYLAVVLDTAMCRPILLGCPEGD
IDDWELVGEKMQHIVVDQEFSPFYARRLALKMGLQGVLMQSVSSVIEKMYHLFLQKDLDL
VEINPLGINASGQVMALNGSVAINERSIARHPDIALVAKKIANRQIKNDNNGNLRNHENT
DGYGKVGILGNGAGSVMSTMDLIANAGGKPGTCLNLRHASPINASPTKFSDRLEKALKIL
GNDKSIQVILINLLGSVPQVNEVANVITSFIEYQKNNSQIYNTSTNGSKARRQASHQRLV
IRLAGSDFDDAKQELATFVSQQNPTTDVFISIVDNLDDAIAEAIRLAKSNQRK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggacttattagagtatcaagttaaagaatggtttggtgatattggtatcccagtatta
ccgtctcaacgaattgatcatccaacagatttaaagcgcttaaaaattcctttccccata
gttctaaaatctcaagtttatgggggcggtaggttaaaatcgggcggagtcagatttgca
gacaccaccattgacgcgatcgcatctgcacagaacatctttaatttatcgattgttggg
gaattgccagaagttgttttggcagaaactaagtacaatgcggagatggaaatatactta
gcagtcgtcctagatactgcaatgtgtcgtccaattctgcttggttgtcctgaaggagat
attgatgattgggaattagtgggggaaaagatgcagcatattgttgtagatcaggagttt
tcacccttttatgcccgtagattagcattaaaaatgggattgcaaggtgtactgatgcaa
tctgtcagtagtgtcatcgaaaaaatgtatcatttgttcttgcaaaaagacttagatttg
gtagaaattaatcctctaggaattaatgctagtgggcaagtgatggcacttaacggtagc
gttgccatcaacgaaagatccatcgctcgtcatcccgacattgcccttgtagccaaaaaa
atagctaatcgtcagattaaaaatgataataatgggaatttaagaaaccatgaaaatact
gatgggtatggaaaagtaggtatactaggcaacggggctggctctgtgatgagtaccatg
gatctgattgccaacgcaggcggaaaaccgggtacatgtctaaatctacgtcatgcttcc
ccaataaatgcatctcccaccaaatttagcgatcgcttagaaaaagctttgaagattctg
ggtaacgataagagtattcaggtgatactaattaatctcctaggaagcgttccccaagtc
aacgaagtcgcaaatgtgatcaccagctttattgagtatcaaaaaaataattcccaaatc
tacaatacatccactaatggcagtaaagccagacgacaagcaagtcaccaacgtttggta
attagacttgcaggttctgacttcgatgacgctaaacaagaattagcaacttttgtttcc
cagcaaaatccgactacagatgtattcatatcaattgtagataatttggatgacgcgatc
gcagaagccatccgactagctaaatcgaaccaacgcaagtga

DBGET integrated database retrieval system