KEGG   Calothrix sp. PCC 6303: Cal6303_4759Help
Entry
Cal6303_4759      CDS       T02372                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:calt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5728959..5729756)
Genome map
AA seq 265 aa AA seqDB search
MLELYQFELSQYSEKVRLILDYKGLDYRKIEVTPGIGQVDLFRLTGQRQVPVLKDGSKYI
TDSTDIAKYLDTQYPERPILPVDSKRRGLTLMMEEWADESIGVKGRKALFSAISKDQSFR
KSLLPNTAPDIFRSLIEGVPNDVFKVLGFGVGYSPEAVSSAIADLKQDLEAVCLILESSP
YLTGDEITLADLSLASLSILLKFPEGDYLDIPYALKGKGVPGLADNPAYAPFFAWRDRIY
LQYRRTSFGRSTSSTVDKPTSIQIE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgttggaattataccaatttgaactttcacagtactctgaaaaagtacgtttaattcta
gactacaagggtcttgattaccgtaaaattgaagtcacaccaggaattggtcaagttgat
ttgtttcgattgacaggacaaagacaggtacctgttctgaaagatggaagtaagtatatt
acagattctacggatatagctaagtacttagatacacaatatcctgagcgcccaatatta
ccagttgatagtaagcgtcggggtttaaccttaatgatggaagaatgggctgacgaatcc
atcggagttaagggaagaaaggctttattttcagctattagtaaagatcaaagtttccga
aaatccctgttacccaatactgcaccggacatatttagaagcttgattgaaggtgttccc
aatgatgtgtttaaggttttgggttttggagtcggttatagtccggaagctgtgagtagc
gcgatcgctgatctcaaacaagacctagaagctgtatgcttgattctagaaagcagtccc
tatttaactggtgatgagataactttagccgatttgagcctagctagcttatcgatatta
ctcaaattccctgaaggtgactatttagacattccctatgcactcaaaggtaaaggtgtc
cctggattggctgataatcccgcttatgccccattctttgcatggcgcgatcgcatttac
ctacaataccgcagaacttcgtttggtagatccacatctagtactgtagataaaccaact
tcgatccaaattgagtaa

DBGET integrated database retrieval system