KEGG   Calothrix sp. PCC 6303: Cal6303_4920Help
Entry
Cal6303_4920      CDS       T02372                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cal6303_4920
Enzymes [BR:calt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cal6303_4920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5921574..5922131)
Genome map
AA seq 185 aa AA seqDB search
MLKLYGAARSRATIIQWQLEELAIPYEFVLLDMQAGEHRQQEFLEINPFGKVPAIVDGDL
KLWESGAILLYLAEKYSPVKYSSNQQAEFAQWVLFANATLGPGIFVEANREKEMPKLMTA
LNGIFEHQPFLMGNEFTVADIAVGSYLSYIPMLLKIDLSEYTYVAKYMEQMQERPAFQKA
FGQRG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattatacggtgctgcccgcagccgtgccacgattatccaatggcagttagaa
gaattagctattccctacgaatttgtcctactggatatgcaagcaggagaacatcgtcaa
caggaattcctcgaaattaaccctttcgggaaagttccagcgattgtggatggtgatttg
aagctatgggaatcgggagcgattttattgtacttagctgaaaaatatagtcccgtcaaa
tattcttcaaatcaacaagctgaatttgcccaatgggttttgtttgccaatgcgactcta
ggacctggtatttttgtcgaagcgaaccgagagaaggaaatgccgaagttaatgacagca
ttgaatggaatttttgagcatcaaccctttttgatgggaaatgagtttacggttgcggat
atcgcagttggctcatatttgagttacatccccatgttacttaaaattgatttaagtgaa
tatacgtatgttgccaagtatatggagcagatgcaagagcgtccagcatttcagaaagct
ttcggacagaggggataa

DBGET integrated database retrieval system