KEGG   Calothrix sp. PCC 6303: Cal6303_5040Help
Entry
Cal6303_5040      CDS       T02372                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:calt00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6063435..6063989
Genome map
AA seq 184 aa AA seqDB search
MAILKREDGSVSTEIAEIVEELAPLGIQLNYWSVGEDENLQELLKRDRLTDSEKETVLQG
LDHYFAQLQESGGYTSRDLIVLYPEVPNLDTMLQKFDKVHTHADDEVRYIVAGEGIFGFV
RPDGSQVELTVQPQEYINVPAGTEHWFYLTPARCVKAVRYFCGTSGWVPEYTETQIRTRQ
EVGV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggctattttaaaacgggaagatggtagtgtttctacagaaatagcagaaattgttgaa
gaattggcaccgctgggaattcaacttaattactggtcggtgggagaggacgaaaatctg
caagaattactaaagcgcgatcgcttaactgattcagagaaggaaactgttcttcaagga
ttggatcactatttcgcacaactccaagaaagtggtggctatacttcgcgggatttaatt
gttctatatcccgaagttcctaatctcgacacaatgctgcaaaaatttgacaaggttcat
acccacgcagatgatgaggtgcgctacattgtcgctggtgagggaattttcggttttgtt
cgtcctgatggtagtcaagttgagttgacggtacaaccccaagagtatattaatgtcccg
gcggggactgaacattggttttatctcacacctgcgcgttgtgtgaaagctgtaaggtat
ttctgtggaactagcggttgggttccagaatataccgaaactcagattcggactcgtcaa
gaagtaggggtgtag

DBGET integrated database retrieval system