KEGG   Calothrix sp. PCC 6303: Cal6303_5040Help
Entry
Cal6303_5040      CDS       T02372                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cal6303_5040
Enzymes [BR:calt01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Cal6303_5040
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Cal6303_5040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6063435..6063989
Genome map
AA seq 184 aa AA seqDB search
MAILKREDGSVSTEIAEIVEELAPLGIQLNYWSVGEDENLQELLKRDRLTDSEKETVLQG
LDHYFAQLQESGGYTSRDLIVLYPEVPNLDTMLQKFDKVHTHADDEVRYIVAGEGIFGFV
RPDGSQVELTVQPQEYINVPAGTEHWFYLTPARCVKAVRYFCGTSGWVPEYTETQIRTRQ
EVGV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggctattttaaaacgggaagatggtagtgtttctacagaaatagcagaaattgttgaa
gaattggcaccgctgggaattcaacttaattactggtcggtgggagaggacgaaaatctg
caagaattactaaagcgcgatcgcttaactgattcagagaaggaaactgttcttcaagga
ttggatcactatttcgcacaactccaagaaagtggtggctatacttcgcgggatttaatt
gttctatatcccgaagttcctaatctcgacacaatgctgcaaaaatttgacaaggttcat
acccacgcagatgatgaggtgcgctacattgtcgctggtgagggaattttcggttttgtt
cgtcctgatggtagtcaagttgagttgacggtacaaccccaagagtatattaatgtcccg
gcggggactgaacattggttttatctcacacctgcgcgttgtgtgaaagctgtaaggtat
ttctgtggaactagcggttgggttccagaatataccgaaactcagattcggactcgtcaa
gaagtaggggtgtag

DBGET integrated database retrieval system