KEGG   Calothrix sp. PCC 6303: Cal6303_5131Help
Entry
Cal6303_5131      CDS       T02372                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal6303_5131
Enzymes [BR:calt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cal6303_5131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6166649..6168175
Genome map
AA seq 508 aa AA seqDB search
MPFPRSSGILLHPTSFPSRFGIGDLGYPARSFIDFLKNSDQQYWQVLPLGPTGYGNSPYM
CYSAMAGNPFLISPDLLKEQNLLADWDFGNLPDFSIEKVNYEQAITIKVRLLKLAFENFK
NLATPEQRQDFAVFCEAKAYWLDDYALFMALKDAHQGASWYQWETKYAKRKPEAIEAATQ
ELSDDIFYYKFLQFEFFLQWSQLKDYANEHSIKIIGDIPIYVAHDSADVWSNPDIFCLNE
KTGEVELMAGVPPDYFSATGQLWGNPVYHWEELEKQDFAWWVKRFEAMLDYVDIIRIDHF
RGFEAFWAVPRGEETAENGKWMKASGDQLFETIRDKLGKLPVLAEDLGIITPDVEALRDK
FEFPGMKVLQFAFGSDPGNEFLPFNYGRNSVVYTGTHDNDTTIGWFNTASDHEKYNLELY
LGGISNDGVHWDLIRMALSSIANQAIIPFQDILSLGGEARMNFPGKPEGNWEWRYHPDSL
SDGLCDRLQNLTRIYGRAPRRRTTEEKS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcctagatccagcggtattctgctacacccaacaagttttcccagtcgtttc
ggaattggggatttgggttatccagcccggagttttattgattttctcaaaaatagtgac
cagcaatattggcaggtgttgccattgggaccgacaggttacggaaactctccgtatatg
tgttactcggcgatggcgggaaatccttttttaatcagcccagatttgctaaaggaacaa
aatttactggctgattgggatttcggtaatttaccagatttttcgattgaaaaggtaaat
tacgaacaagctattactattaaagttagattgttaaagctggcttttgagaattttaaa
aatctggcaacaccagaacaacgccaagattttgctgttttttgcgaagctaaggcatat
tggttagatgattatgctttgtttatggcgctcaaagatgcccatcaaggtgctagttgg
tatcagtgggagacaaagtatgccaagcgcaaaccagaagctattgaggcagctactcag
gaactgagtgatgatattttctattacaaatttctgcaatttgagtttttcttacagtgg
tcacaactcaaagattatgccaatgaacatagtattaaaattattggtgatatacctatt
tatgtagcacacgatagtgctgatgtgtggtcaaatccagatatattttgtttgaatgaa
aagactggtgaagttgaattaatggctggtgtgccacctgactactttagtgcaactggt
caactttggggaaatccagtttaccactgggaagagttggaaaaacaagattttgcttgg
tgggtgaagcgctttgaggcgatgctggattatgttgatattattcgcattgatcatttt
cgcggatttgaagctttttgggctgttccccgtggggaagaaacggcggaaaatggtaaa
tggatgaaggcatctggagatcaattatttgaaactatccgcgataagttgggaaaacta
cctgttttagctgaagatttggggattattacacccgatgtggaagctttgcgagataag
tttgagtttccagggatgaaagtcttgcagtttgcttttggttcggatcctggtaatgag
tttttaccgtttaattatggacgaaattcggttgtttatactggaacccatgacaatgac
actacaattgggtggtttaatacagctagtgatcatgaaaaatacaatttggaattatat
ctaggtggcattagtaacgatggtgtccattgggatttaattcgtatggcattaagttcc
attgccaaccaagcaattattccctttcaggatattttatccttgggtggagaagcgcga
atgaattttccaggaaaaccagaaggtaactgggaatggagatatcacccagatagcctc
agcgatggtttatgcgatcgcttacagaatctaactaggatatatggacgcgcaccccgt
cggcgaactactgaagaaaaatcttaa

DBGET integrated database retrieval system