KEGG   Calothrix sp. PCC 6303: Cal6303_5279Help
Entry
Cal6303_5279      CDS       T02372                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cal6303_5279
Enzymes [BR:calt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cal6303_5279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6361976..6362473
Genome map
AA seq 165 aa AA seqDB search
MDKEINKSAIALGSNLGNSLEILESAIASLVEIPGIRLNRKSSWYRTKAIGPPQPDYING
CVILEVEMTPELLLATLLKIETDFGRVRQERWGARTLDLDILLYADRIIDLPTLQIPHPR
MCDRAFVLVPLNEIAPDWIVPVSGFAIKDVIKAVDCSDVSLLMGN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagaaatcaataagagcgccatcgcattgggaagcaatttaggtaattcactg
gagattttggaaagtgcgatcgcttctttagtcgaaataccgggaattaggttgaatcga
aaatccagttggtatcgtaccaaagctattggtcccccgcaacctgactatataaatggc
tgtgtcattttggaggtagagatgacaccggagttgttgttagcaactttattaaaaata
gaaaccgattttggcagagttagacaagaacgctggggggcaagaaccctagatttggat
atcctattgtatgcagatagaattatagatttaccaacgctacagataccccatccgcgc
atgtgcgatcgcgcttttgttttggtaccattaaatgaaattgcaccagactggattgta
ccagtttccggatttgcaattaaagacgtgattaaagcagtagattgttctgatgtatcc
cttttaatgggaaactaa

DBGET integrated database retrieval system