KEGG   Calothrix sp. PCC 6303: Cal6303_5335Help
Entry
Cal6303_5335      CDS       T02372                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
calt  Calothrix sp. PCC 6303
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal6303_5335
Enzymes [BR:calt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cal6303_5335
Exosome [BR:calt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cal6303_5335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6419467..6421767)
Genome map
AA seq 766 aa AA seqDB search
MSMTTIAPEQVNRIIWNQHHDPFEILGSHLVEQNGKNVWAVRAYLPNATEVWVVLPEERK
EYPMQTVHDPHFFECIIENPKLTNYQLRIKEGDHELVVYDPYSFRSPNLTEFDLHLFSEG
NHHRIYEKLGAHLSEVDGVKGVYFAVWAPSARNISVLGDFNLWDGRKHQMRRGSTGVWEL
FIPELTVGTHYKYEIKNNEGHIYEKTDPHGFQQEPRPKTASIVTDLNTYKWNDANWMEKR
RHTEPLNQPISVYEVHIGSWLHAASSEPAKLPNGELSPVVTVSELNPGARFLTYRELAER
LIPYVKELGYTHIELLPISEHPFDGSWGYQVSGYYAPTSRFGTPEDFMYFVDQCHSNDIG
VIIDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRNEVRNFLVANAL
FWLDKYHIDGIRVDAVASMLYLDYCRKDGEWVTNQYGGRENIEAADFLRQTNHLIFSYFP
GAISVAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYHHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKFANTRCLFSYMFAHPGKKTMFMSME
FGQWSEWNVWSDLDWKLLQYEAHQQLKQFFQDLNHLYRSEPALYSQDFAEEGFEWIDCTD
NRHSVASFIRRDKDSNDFVITVCNFTPQPHSHYRIGVPEMGFYTELFNSDARKYGGSNMG
NLGGKWTDNWSMHNREYSIDLCLPPLGVLILKLDKKKTTAALKQES
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaccacaattgcaccagaacaggttaaccgcatcatctggaaccaacatcac
gacccttttgaaattctaggttctcacttagtagagcaaaatggcaaaaatgtctgggct
gtgcgagcttatctaccaaatgccaccgaagtttgggtcgttttgcccgaagaacgaaaa
gaataccccatgcagacggttcatgaccctcacttttttgaatgcatcattgaaaaccca
aaattaacaaactatcaactacggatcaaagaaggcgatcacgagcttgttgtctatgat
ccatattccttccgttcgcccaacttaacagaattcgatttacacttattttctgaaggt
aatcaccatcggatctatgaaaagctgggggcacacctcagcgaagtcgatggtgttaaa
ggcgtgtattttgccgtgtgggcacccagcgctcggaatatctcagttctaggggatttc
aacctttgggacggacgcaagcatcaaatgcgccgaggttctacaggtgtttgggaactc
ttcatccccgaacttaccgttggaacacactacaaatacgaaattaagaataacgaagga
catatttacgaaaaaaccgatccccacggctttcaacaagaacctcgccccaaaaccgca
tcaatcgtcacggatctcaacacctacaagtggaatgatgccaactggatggaaaaacgc
cgtcacaccgaacctctcaaccaaccaatttcggtgtatgaggtacatatcggttcttgg
ttacatgctgccagtagtgagcctgctaaactccccaacggcgaattatccccagtggtt
acagtgtcagaacttaaccccggtgcgcgctttcttacgtaccgcgaactagctgaaaga
ttaattccctacgtcaaagagttaggatacacccacatagaacttctacccatctccgaa
cacccatttgatggttcctggggttatcaagtcagcgggtattatgcccccacttcccga
ttcggtacccctgaagattttatgtattttgtggatcaatgtcattccaatgatattggt
gtaattatcgattgggttcccggtcattttcccaaggatgggcatggtttagcatttttt
gatggaacacacctttatgaacatgcagacccccgcaaaggtgaacacaaagaatggggt
acattagtatttaactattctcgcaacgaagttaggaatttcctcgttgctaatgcttta
ttttggctagataagtaccacattgatgggattcgtgttgatgctgtggcatcgatgcta
taccttgattactgccgtaaagatggcgaatgggtaactaatcagtatggtggtagagaa
aatattgaagctgccgatttcctccgtcaaacaaaccacctgatttttagttactttcct
ggtgcaatttccgttgccgaagaatctacatcttggcccatggtatcttggcccacatac
gttggtggtttaggtttcaatttaaaatggaacatgggttggatgcacgatatgttggat
tatttcagcatggatccctggttccgtcagttccaccaaaataatattacctttagcatg
tggtatcaccacagcgagaacttcatgctggcgctttcccacgatgaggtggtacatgga
aagagtaatatcatcggtaaaatgccgggggataggtggcaaaagttcgccaatactcgc
tgcttatttagctacatgtttgctcaccctggcaaaaaaaccatgtttatgagtatggaa
tttgggcagtggagtgagtggaatgtttggagtgatttagattggaagctattgcagtat
gaagctcatcagcaattaaagcagtttttccaagatttaaatcatctctatcgctctgaa
ccagccttatattcccaggattttgctgaggaagggtttgagtggattgattgtactgac
aatcgccatagtgttgcttcttttattcgtcgtgacaaagatagtaatgattttgtgatt
accgtttgcaatttcacccctcaaccccactcccattaccggattggtgttccggaaatg
ggtttttacacagagttatttaatagtgatgctcgcaaatatggcggcagtaacatgggt
aacttaggcgggaagtggactgataactggtcgatgcataatcgtgagtattctatagat
ctgtgcttgccgcctctaggtgtactgattttgaaattggataaaaagaagacaacagca
gcgctgaagcaagagtcataa

DBGET integrated database retrieval system