KEGG   Calothrix sp. PCC 6303: Cal6303_5613Help
Entry
Cal6303_5613      CDS       T02372                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
calt  Calothrix sp. PCC 6303
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cal6303_5613
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cal6303_5613
Enzymes [BR:calt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cal6303_5613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6747418..6748506)
Genome map
AA seq 362 aa AA seqDB search
MTSLAHTRKFGHHLILGVSGTKLSDDDKKLLRDLNPVGVIFFAANFRQDVPYDAWVESLG
DLTNQVRQYAERDRMFVTIDHEGGRVVRSPLPITRFPYAAFYGERSFAVGKATGIELKSL
GINVSWSPVADIFSNPNNPIIGPRAFGVTEDTAALHAVEYLQGLREAGITGCAKHFPGHG
DTSTDSHLELPVLNLTKAEMRSRELIPFQKLIAAGVPLVMTAHILFPKIDANAPATLSKL
VLKDMLRQELGFSGVVVSDDLDMKAVADLFTHPGTVAQSVNAGCDLFIVSRNLPSSTVER
VYAIASDFATSLSNGSLHESVISSAKQRIDELLAITPQYSVSLLDKNTLLAHAELAIDCM
MN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacttcattggcacacacaaggaaatttggtcatcatctaattttgggtgtttctggt
acaaaattaagtgatgatgacaaaaagcttctcagggatttaaatcctgtaggggtgata
ttttttgcggcgaattttcgtcaagatgtcccttacgatgcttgggttgaaagtttgggt
gatttaacgaatcaagttaggcagtatgcagaacgcgatcgcatgtttgtcacaatagac
catgaggggggtcgggtggtgcgttctcctttaccgattactcggtttccctatgctgca
ttttatggggaaagatcatttgctgtggggaaagcgacgggaatagaattaaaatccctg
ggaattaatgtatcttggtctccagtggcggatattttttctaaccctaataacccaatt
attggaccaagggcttttggtgttacggaagatactgctgccctccatgctgttgagtac
ctccaaggacttagggaagcgggaattactggttgtgccaagcatttccctggacatggg
gacactagtactgattcgcatttggagctaccagtattaaacctcactaaagccgaaatg
cgatcgcgtgaattgattcctttccaaaaattgattgcagcgggtgtcccattggtgatg
acagcacatattttgtttcccaaaatcgatgcaaatgcacctgcgactctttcaaaacta
gttttaaaggatatgttgcgtcaggaattaggtttttccggtgtggtggtgtcggatgat
ttggatatgaaagctgttgctgatttatttacccacccaggaacagttgcacaatctgta
aatgcagggtgtgatctatttattgtttctcgcaacttaccaagttctacggttgaaaga
gtttatgcgatcgcatctgattttgcaacttctttgagtaacggtagcttgcatgagtcg
gttatttctagtgcaaaacaaagaattgatgaattacttgccatcacacctcaatattct
gtcagtttattagataaaaataccctactagctcatgccgaattagcaatcgattgtatg
atgaattag

DBGET integrated database retrieval system