KEGG   Cicer arietinum (chickpea): 101488527Help
Entry
101488527         CDS       T02819                                 

Definition
MYST-like histone acetyltransferase 2-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101488527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 464 aa AA seqDB search
MGSLDAPISAENGSVHAAGHGKSPLIDVAARAAPADSTPDFDTSKRRRSSVLPLEVGTRV
MCRWRDSKYHPVKVIERRRVHGSGPNDYEYYVHYTEFNRRLDEWVKLDQLDLDSVEAVVD
EKVEEKGATGLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIE
TWYFSPFPPEYNDCLKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFE
VDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEE
SYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLL
DILKKHKGNISIKVTLFHFYLLMSGNGKFKFICLQIIKLFEFLVSVELAFMLILIIFNKI
TCWDIGDVWTNNLPKCLLYESLCINSFYLSMLWLLKKCCFTGTE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgctcgacgcaccgatcagtgcggaaaacggttccgttcacgccgccgggcac
ggcaaatctccgttaattgatgtcgctgcacgcgccgcaccggcagattcgacgccagat
ttcgacacatcgaagcggcggagatcgtctgtacttcccttggaggttgggacgcgcgtg
atgtgtcgttggagggactcgaagtatcatcctgtcaaagttatcgaacgccgcagagtt
catggctctggacctaatgattacgagtattacgttcattatactgagttcaataggagg
cttgatgagtgggtgaagcttgatcagctcgatcttgattctgtggaggcagttgttgat
gagaaagtggaggagaagggggcaacaggtttgaagatgacacgccaccaaaagaggaag
atcgatgagacgcatgtagagggccatgaggagcttgatgctgctagtttgcgagaacat
gaagaatttacaaaagtgaaaaacatagctactattgaacttggaagatatgagattgag
acatggtacttctctccgttcccaccagaatacaatgactgtttgaagctgttcttttgt
gagttttgcctcaatttcatgaagcgcaaagaacagctccagaggcatatgaaaaaatgt
gatcttaagcatccccctggtgatgagatatacagaagtggtacactgtcaatgtttgag
gttgatggcaagaagaacaaggtttatgggcagaatctttgttatttggccaagttattt
cttgatcacaagaccctctattatgatgttgacctgtttctgttctatgttttgtgcgaa
tgtgatgatcgaggatgccacatggttggatatttttccaaggaaaaacattctgaggaa
tcttacaatttggcatgtatcctcacccttccaccttaccaaaggaaaggctatggaaaa
tttctgattgctttctcctatgaactttcaaagaaggagggaaaagttggcacaccagaa
agacccctttctgaccttggactgctaagctacagaggatattggaccagggttctgtta
gacattctgaaaaagcataagggaaacatttctatcaaggtaaccctcttccatttttat
cttttaatgtccggcaatggcaaattcaagtttatatgtttacaaataataaaacttttt
gagtttttggtctctgttgaacttgcttttatgttgattttgattatttttaataagatt
acttgctgggatataggagatgtttggacaaacaacttacctaagtgtttattatatgag
agtttatgtatcaactctttctatttgtcaatgctatggctattgaagaagtgctgtttt
acaggaactgagtga

DBGET integrated database retrieval system