KEGG   Cicer arietinum (chickpea): 101488527Help
Entry
101488527         CDS       T02819                                 

Definition
(RefSeq) histone acetyltransferase of the MYST family 2-like
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101488527
Chromosome [BR:cam03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101488527
   HAT complexes
    NSL complex
     101488527
    MSL complex
     101488527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Ca5
AA seq 440 aa AA seqDB search
MGSLDAPISAENGSVHAAGHGKSPLIDVAARAAPADSTPDFDTSKRRRSSVLPLEVGTRV
MCRWRDSKYHPVKVIERRRVHGSGPNDYEYYVHYTEFNRRLDEWVKLDQLDLDSVEAVVD
EKVEEKGATGLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIE
TWYFSPFPPEYNDCLKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFE
VDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEE
SYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLL
DILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAG
RGGLEVDVCKLIWTPYKEQS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgctcgacgcaccgatcagtgcggaaaacggttccgttcacgccgccgggcac
ggcaaatctccgttaattgatgtcgctgcacgcgccgcaccggcagattcgacgccagat
ttcgacacatcgaagcggcggagatcgtctgtacttcccttggaggttgggacgcgcgtg
atgtgtcgttggagggactcgaagtatcatcctgtcaaagttatcgaacgccgcagagtt
catggctctggacctaatgattacgagtattacgttcattatactgagttcaataggagg
cttgatgagtgggtgaagcttgatcagctcgatcttgattctgtggaggcagttgttgat
gagaaagtggaggagaagggggcaacaggtttgaagatgacacgccaccaaaagaggaag
atcgatgagacgcatgtagagggccatgaggagcttgatgctgctagtttgcgagaacat
gaagaatttacaaaagtgaaaaacatagctactattgaacttggaagatatgagattgag
acatggtacttctctccgttcccaccagaatacaatgactgtttgaagctgttcttttgt
gagttttgcctcaatttcatgaagcgcaaagaacagctccagaggcatatgaaaaaatgt
gatcttaagcatccccctggtgatgagatatacagaagtggtacactgtcaatgtttgag
gttgatggcaagaagaacaaggtttatgggcagaatctttgttatttggccaagttattt
cttgatcacaagaccctctattatgatgttgacctgtttctgttctatgttttgtgcgaa
tgtgatgatcgaggatgccacatggttggatatttttccaaggaaaaacattctgaggaa
tcttacaatttggcatgtatcctcacccttccaccttaccaaaggaaaggctatggaaaa
tttctgattgctttctcctatgaactttcaaagaaggagggaaaagttggcacaccagaa
agacccctttctgaccttggactgctaagctacagaggatattggaccagggttctgtta
gacattctgaaaaagcataagggaaacatttctatcaaggaactgagtgatatgactgcc
attaaagctgaagatatattgacaactcttcagagcttagaactgattcaatacaggaaa
ggacaacatgtcatttgtgctgatccaaaagttttggatcgccatctcaaagcagctggc
agagggggtcttgaggttgatgtttgcaaattgatttggacaccttataaagaacaaagt
tga

DBGET integrated database retrieval system