KEGG   Cicer arietinum (chickpea): 101488572Help
Entry
101488572         CDS       T02819                                 

Definition
glycerol-3-phosphate dehydrogenase [NAD(+)]-like
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101488572
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     101488572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca2
AA seq 377 aa AA seqDB search
MAPALEAQGGETLSQNSFLNSVGDVTNRSKVTVIGSGNWGSVASKLIASNTLRLSNFHDE
VRMWVYEETLPSGEKLTDVINQTNENVKYLPGIKLGKNVVADPDLENAVRDANMLVFVTP
HQFMEGICKRIAGKIRADAEAISLVKGMEVKMEGPCMISTLISHELGINCSVLMGANIAN
EIAVEKFSEATVGYRQNREAAERWVHLFYTPYFIVTAVQDVEGVELCGTLKNVVAIAAGF
VDGLEMGNNTKAAIMRLGLREMKAFSKLLFPSVKDSTFFESCGVADLITTCLGGRNRKVA
EAYAKNGGKRSFDELEVEMLQGQKLQGVSTAREVYEVLSHRGWLELFPLFSTVHEISSGL
LPPSAIVEYSEKSPRSF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctccagcacttgaagctcaaggaggagaaactttatctcagaacagttttttgaac
agtgttggtgatgttacaaacagatccaaagtcactgttattggtagtggaaattggggt
agtgttgcatctaaacttattgcctctaacactctaaggctcagcaatttccatgatgaa
gttaggatgtgggtatatgaggagacattaccaagtggagagaagctcacagatgtcatc
aatcaaaccaatgaaaatgtaaaatatctacctggaattaagcttggcaaaaatgttgtt
gcagatccagatcttgaaaatgcagtgagggatgcaaatatgttggtgtttgtgactcca
caccaatttatggaaggaatatgcaaaaggatagcagggaaaataagggcagatgctgag
gctatttcccttgttaaaggaatggaagtcaaaatggaaggaccttgcatgatctctact
ctcatttctcatgaattaggaatcaattgttcagttttgatgggagccaacatagcaaat
gagatagctgtagagaagtttagtgaagcaactgttggatacagacagaacagagaagct
gcagagagatgggttcatttgttttatactccttatttcattgtgacagctgttcaagat
gttgaaggagttgaattatgtggaacactaaaaaatgttgtggccatagcagcaggtttt
gttgatggcctggagatgggaaataatacaaaagctgctatcatgagacttggtcttaga
gaaatgaaggcattttcaaagttgttgtttccatctgttaaggatagtaccttttttgag
agctgtggtgtagctgaccttatcacaacatgcttgggaggaaggaacaggaaagttgct
gaggcttatgcaaagaatggagggaagagatcttttgatgagcttgaagttgagatgcta
caaggccagaagttgcagggtgtctcaactgcaagggaagtatatgaagttctaagccat
cgtggctggctagagttattccctctcttctcaacagttcatgaaataagcagtggtctc
cttccaccatcagccattgttgaatatagtgagaagtcaccaaggtccttctaa

DBGET integrated database retrieval system