KEGG   Cicer arietinum (chickpea): 101488701Help
Entry
101488701         CDS       T02819                                 

Definition
NADH--cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101488701
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101488701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca7
AA seq 296 aa AA seqDB search
MLELPFNMTLNFPTLFFKSLPFAQNLEPELLNGAIALVAVGLTAAYIYYHKNRKGCLDPK
NFKEFKLVKKTQISPSAARFRFALPTPNSILGLPVGKNILARGRDSQGDVVMRSYTPITL
NSDIGYFELVVKMYPNGKMSHHFRQLKEGDNLAVKGPKGRFSYKPGQVRAFGMIAGGSGI
TPMFQLIRAILENPKDKTKVYLIYANVTVDDILLKEELDRFADTFPHRFQVYHVLNKPPN
QWNGGVGFISKEIIESHCPAPATDIQILRCGPPPMNKAMAIHLEALGYTSNMQFQF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttggagttaccattcaatatgacacttaacttccccacattgtttttcaagtcatta
ccttttgctcaaaacttggagcctgaattgttaaatggagcaattgctcttgttgctgtt
ggccttacagctgcttatatttactatcacaagaaccgcaaaggttgcttggaccccaaa
aatttcaaagaatttaaacttgtaaagaagacccagatcagccctagtgctgcaagattc
agatttgcccttcctactcctaattcgatattaggccttcctgttggtaaaaacatactt
gcaagaggaagagatagtcaaggagatgtagttatgagatcatatactccaatcacattg
aattcagatattggctattttgaattagttgtgaagatgtacccaaatggaaagatgtcc
caccattttagacaattgaaggaaggtgacaacttggccgtgaagggccccaagggacgt
ttcagttacaaacctggccaagttagggcatttggaatgattgctggtggttcaggaatt
accccaatgtttcagctcataagagccatattagaaaacccaaaggacaaaacaaaggtg
tacctcatttatgccaatgtgactgtggacgacatcctactaaaggaagaattagatcgc
tttgcggacacatttcctcatagattccaagtctatcatgttttaaataagcctcctaat
caatggaatggtggagttgggttcatttcgaaggagattatcgaatcccattgtccagca
ccagccactgatatccagatacttaggtgcggtccaccacccatgaataaagccatggca
attcaccttgaagcacttggatacacatcaaacatgcagttccaattctag

DBGET integrated database retrieval system