KEGG   Cicer arietinum (chickpea): 101489034Help
Entry
101489034         CDS       T02819                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00220  Arginine biosynthesis
cam00250  Alanine, aspartate and glutamate metabolism
cam00710  Carbon fixation in photosynthetic organisms
cam01100  Metabolic pathways
cam01200  Carbon metabolism
cam01210  2-Oxocarboxylic acid metabolism
cam01230  Biosynthesis of amino acids
Module
cam_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101489034
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101489034
   00220 Arginine biosynthesis
    101489034
Enzymes [BR:cam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101489034
Amino acid related enzymes [BR:cam01007]
 Aminotransferase (transaminase)
  Class I
   101489034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 101489034
NCBI-ProteinID: XP_004510570
UniProt: A0A1S2YVG4
Position
Ca7
AA seq 531 aa AA seqDB search
MRKSAADRFKHLFNRSLVFVRHQNQQHNSSSPLHYRLLSSAHFSSMASDSPFPVTAQNIN
PQVLQCQYAVRGEIVTLAQNLQKDLQANPGSHSFDEIIYCNIGNPQSLGQQPITFFREVL
ALCDYPALLDKSETQGLFSADSIERAWQIVEQIPGRATGAYSHSQGIQGLRDTIAAGIQE
RDGFPANANDIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPLYSASITLHGGHLVPY
YLDEATGWGLEVSEVKKQLEDAKSKGISVRALVVINPGNPTGQVLAEENQRDIVEFCKQE
GLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGDDDISLVSFQSVSKGYHGECGKRGGY
MEVTGFSPDVREQIYKVSSVNLCSNITGQILASLVMSPPKVGDESYESFMAEKGSILSSL
ATRAKSLEEALNKLEGVTCNKAEGAMYLFPQIRLPKKAIEAAEAENTAPDAFYCKRLLNA
TGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTEFHEKFMDEFRD
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatccgctgcagacagattcaagcaccttttcaatcgttcccttgtttttgtt
cgacatcaaaatcagcaacacaattcttcttctcctcttcactatcgtttgttatcttct
gctcatttttcttcaatggcttctgattcccctttccctgttaccgctcaaaatattaac
cctcaggttctgcaatgtcagtatgctgttcgaggagagattgttacacttgcccagaat
ttgcaaaaagatttgcaggccaatccaggctctcattcgtttgatgagataatttattgc
aacattgggaatcctcagtctcttggccagcagccaataacttttttccgagaggttctt
gcattgtgtgactatccagctcttttggacaaaagtgaaacacagggtttgttcagtgct
gattcaatagagcgagcatggcagattgtggaacagattcctgggagagcaactggtgct
tatagtcatagtcagggtattcagggtttgcgtgatacaatagccgctggaattcaagaa
cgtgatggttttcctgctaatgccaatgatattttcttgaccgatggtgcaagcccagca
gtccatatgatgatgcaattactcataagatcagaaaatgatggtattttgtgtcccatc
cctcaataccctctatactccgcctcaattactctccatggtggccacctggtaccttat
tacctagatgaagcaactggttgggggctggaagtatctgaagtcaagaagcagttggaa
gatgccaagtccaagggcatcagtgttagggctttagttgttataaatcccggcaatcca
acagggcaggttcttgctgaggaaaatcaacgggatatagtagaattttgcaagcaagaa
ggtttggtccttttggctgatgaggtatatcaagaaaatgtttatgttcccgagaagaaa
tttcactctttcaagaaggtatctcgatccatgggatacggtgatgatgatatctcctta
gtatcttttcagtcagtttccaaaggctatcacggggagtgcgggaaacgaggaggttac
atggaggtgactggtttctctccagatgtgagggaacagatttataaagtgtcatcagtg
aatctttgttctaacatcactggtcaaattcttgcaagtttggtcatgagtccacctaag
gttggagatgagtcctatgagtcattcatggctgagaagggtagtattttgtcttccctt
gctacgcgcgcaaagtcactggaagaagctttgaacaaattagagggtgtaacctgcaac
aaagcagaaggagcaatgtatctgtttcctcagattcgcctgcccaaaaaggcgatcgaa
gctgcagaggccgaaaacacagcacctgatgccttctattgcaaacgcttacttaatgcc
acaggagttgttgtcgttcccggttctggttttggacaggttcctggcacatggcatttt
aggtgcacaattttgcctcaagaagataagattccagccattgtcactcgcttgacagag
tttcatgaaaagttcatggatgagtttcgtgattga

DBGET integrated database retrieval system