KEGG   Cicer arietinum (chickpea): 101489834Help
Entry
101489834         CDS       T02819                                 

Definition
(RefSeq) pectinesterase PPME1-like
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00040  Pentose and glucuronate interconversions
cam01100  Metabolic pathways
Module
cam_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101489834
Enzymes [BR:cam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101489834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 101489834
NCBI-ProteinID: XP_004516439
UniProt: A0A1S2Z7J9
Position
Un
AA seq 367 aa AA seqDB search
MTSKTRTFTINVAIIVALFSANVVLSDDNAAVPAERAEVDSWFNSNIGPLEQRKSTLDPA
LVTAEANATIVKVNQDGSGDFKSITDAINSIPSGNTQRVILNIGGGNYQEKIKIEKTKPF
ITFIGTPSNMPNLTYGGTAQEYGTVDSATLIVESDYFVASNIMISNSAPRPDGKKSGAQA
VAMRITGDKAAFYNCKFLGFQDTICDDKNIHFFKDCLIQGTVDFIFGNGRSLYLKNELRV
LGNAEMTVIVAQARKSESEKSLYTFVHCDVTGTGTGTYLGRAWMAYSKVIFAYSTLSSVL
NPLGWSNNRHPEYDKTSYFGEYMNTGPGADTKGRAPITRQLTDAEVKPFLTLGSIEASKW
LLPPPKA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaaaacaagaacctttaccatcaatgttgcaatcatagtagcattgttcagc
gccaatgttgtattatcagatgacaatgctgcagtccctgctgaaagagccgaagtagat
tcatggttcaatagcaatataggtccattagaacaaagaaaaagcacccttgaccctgca
ttggtaactgcagaggcaaatgctaccattgtgaaagtaaatcaagatggtagtggtgat
ttcaaatccataactgatgccattaatagcattccaagtgggaacacccaacgtgtgatt
ctgaatattggtggtggaaattatcaggagaaaattaaaattgaaaagacaaagcctttt
attacatttattggtacaccaagcaatatgccgaatttgacatatggtggtactgcacaa
gaatatggcacggttgatagtgctacactgattgttgaatcagattattttgttgcttct
aacatcatgatatcgaattctgcaccaagacctgatggaaaaaagtcaggtgctcaagca
gttgcaatgagaattacaggtgacaaagcagcattttataattgcaagtttttggggttc
caggacacaatttgtgatgacaagaatatacactttttcaaagattgcttaatccaaggc
acagtggacttcatttttggaaatggaaggtcattatatttgaaaaatgaattgagagta
cttggtaacgctgaaatgacagtgatagtggcacaagcaagaaaaagtgaatcagagaag
agtttatacacatttgtgcattgtgatgtaactggaactggaactggcacttacttagga
agagcatggatggcttattccaaagttatctttgcttattcaactttgagtagtgttcta
aatccattagggtggagtaacaacaggcaccctgaatatgacaaaacttcatattttgga
gagtacatgaacacaggaccaggagcagataccaaagggcgagcacctatcacaagacaa
cttactgatgcagaggttaaacctttccttacgcttggatcgattgaagcttctaaatgg
ttgcttcctcctccaaaagcctaa

DBGET integrated database retrieval system